05-23-2005 Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem

05-23-2005
Cenu nelze zjistit
Minimum Quantity needs to be mulitiple of
S dokončenou objednávkou Další informace
Ušetřili jste ()
 
Vyžádat nacenění
Omezená dostupnostOmezená dostupnost
Na skladě 
Přerušeno
Dostupné omezené množství
Dostupnost bude potvrzena
    Remaining : Will advise
      Remaining : Will advise
      Bude poskytnuto
      Kontaktujte Zákaznický servis
      Contact Customer Service
      Zobrazit ceny a dostupnost
      Klikněte pro vytištění této stránky

      Přehled

      Replacement Information

      Tabulka spec. kláve

      Empirical FormulaCAS #
      C₁₈₉H₂₈₅N₅₅O₅₇S 90880-35-6

      Ceny a dostupnost

      Katalogové čísloDostupnost Balení ks/bal. Cena Množství
      05-23-2005-0.5MG
      Zjišťuji dostupnost...
      Omezená dostupnostOmezená dostupnost
      Na skladě 
      Přerušeno
      Dostupné omezené množství
      Dostupnost bude potvrzena
        Remaining : Will advise
          Remaining : Will advise
          Bude poskytnuto
          Kontaktujte Zákaznický servis
          Contact Customer Service

          Skleněná láhev .5 mg
          Zjišťuji cenu...
          Cenu nelze zjistit
          Minimum Quantity needs to be mulitiple of
          S dokončenou objednávkou Další informace
          Ušetřili jste ()
           
          Vyžádat nacenění
          05-23-2005-1MG
          Zjišťuji dostupnost...
          Omezená dostupnostOmezená dostupnost
          Na skladě 
          Přerušeno
          Dostupné omezené množství
          Dostupnost bude potvrzena
            Remaining : Will advise
              Remaining : Will advise
              Bude poskytnuto
              Kontaktujte Zákaznický servis
              Contact Customer Service

              Plastová ampulka 1 mg
              Zjišťuji cenu...
              Cenu nelze zjistit
              Minimum Quantity needs to be mulitiple of
              S dokončenou objednávkou Další informace
              Ušetřili jste ()
               
              Vyžádat nacenění
              Description
              OverviewA potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells.
              Catalogue Number05-23-2005
              Brand Family Calbiochem®
              SynonymsNPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂
              References
              ReferencesXiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
              Wahlestedt, C., et al. 1993. Science 259, 528.
              Leibowitz, S.F. 1992. NeuroReport 3, 1023.
              Product Information
              CAS number90880-35-6
              ATP CompetitiveN
              FormWhite to off-white lyophilized solid
              FormulationSupplied as trifluoroacetate salt. Sold on the basis of peptide content.
              Hill FormulaC₁₈₉H₂₈₅N₅₅O₅₇S
              Chemical formulaC₁₈₉H₂₈₅N₅₅O₅₇S
              ReversibleY
              Sold on the basis of peptide contentY
              Applications
              Biological Information
              Primary TargetA potent vasoconstrictor
              Purity≥97% by HPLC
              Physicochemical Information
              Cell permeableN
              Peptide ContentY
              Peptide SequenceH-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH₂
              Dimensions
              Materials Information
              Toxicological Information
              Safety Information according to GHS
              Safety Information
              R PhraseR: 20/21/22

              Harmful by inhalation, in contact with skin and if swallowed.
              S PhraseS: 36

              Wear suitable protective clothing.
              Product Usage Statements
              Storage and Shipping Information
              Ship Code Ambient Temperature Only
              Toxicity Harmful
              Storage -20°C
              Protect from Moisture Protect from moisture
              Do not freeze Ok to freeze
              Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
              Packaging Information
              Transport Information
              Supplemental Information
              Specifications

              Documentation

              MSDS

              Title

              Safety Data Sheet (SDS) 

              Certificates of Analysis

              TitleLot Number
              05-23-2005

              References

              Přehled odkazů
              Xiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
              Wahlestedt, C., et al. 1993. Science 259, 528.
              Leibowitz, S.F. 1992. NeuroReport 3, 1023.
              Data Sheet

              Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

              Revision18-September-2008 RFH
              SynonymsNPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂
              DescriptionA potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells.
              FormWhite to off-white lyophilized solid
              FormulationSupplied as trifluoroacetate salt. Sold on the basis of peptide content.
              CAS number90880-35-6
              Chemical formulaC₁₈₉H₂₈₅N₅₅O₅₇S
              Peptide SequenceH-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH₂
              Purity≥97% by HPLC
              Solubility5% Acetic acid (1 mg/ml)
              Storage -20°C
              Protect from moisture
              Do Not Freeze Ok to freeze
              Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
              Toxicity Harmful
              Merck USA index14, 6485
              ReferencesXiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
              Wahlestedt, C., et al. 1993. Science 259, 528.
              Leibowitz, S.F. 1992. NeuroReport 3, 1023.