05-23-2151 PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem

05-23-2151
Cenu nelze zjistit
Minimum Quantity needs to be mulitiple of
S dokončenou objednávkou Další informace
Ušetřili jste ()
 
Vyžádat nacenění
Omezená dostupnostOmezená dostupnost
Na skladě 
Přerušeno
Dostupné omezené množství
Dostupnost bude potvrzena
    Remaining : Will advise
      Remaining : Will advise
      Bude poskytnuto
      Kontaktujte Zákaznický servis
      Contact Customer Service
      Zobrazit ceny a dostupnost
      Klikněte pro vytištění této stránky

      Přehled

      Replacement Information

      Tabulka spec. kláve

      Empirical FormulaCAS #
      C₁₄₂H₂₂₄N₄₀O₃₉S 127317-03-7

      Ceny a dostupnost

      Katalogové čísloDostupnost Balení ks/bal. Cena Množství
      05-23-2151-0.5MG
      Zjišťuji dostupnost...
      Omezená dostupnostOmezená dostupnost
      Na skladě 
      Přerušeno
      Dostupné omezené množství
      Dostupnost bude potvrzena
        Remaining : Will advise
          Remaining : Will advise
          Bude poskytnuto
          Kontaktujte Zákaznický servis
          Contact Customer Service

          Skleněná láhev .5 mg
          Zjišťuji cenu...
          Cenu nelze zjistit
          Minimum Quantity needs to be mulitiple of
          S dokončenou objednávkou Další informace
          Ušetřili jste ()
           
          Vyžádat nacenění
          Description
          OverviewIncreases cAMP levels in a dose-dependent manner (EC50 = 4.7 nM). Increases tyrosine hydroxylase expression in chromaffin cells.
          Catalogue Number05-23-2151
          Brand Family Calbiochem®
          SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂
          References
          ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
          Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027.
          Product Information
          CAS number127317-03-7
          ATP CompetitiveN
          FormWhite to off-white solid
          FormulationSupplied as a trifluoroacetate salt.
          Hill FormulaC₁₄₂H₂₂₄N₄₀O₃₉S
          Chemical formulaC₁₄₂H₂₂₄N₄₀O₃₉S
          Hygroscopic Hygroscopic
          ReversibleN
          Sold on the basis of peptide contentY
          Applications
          Biological Information
          Primary TargetIncreases cAMP levels
          Primary Target IC<sub>50</sub>EC50 = 4.7 nM increasing cAMP levels in a dose-dependent manner
          Purity≥98% by HPLC
          Physicochemical Information
          Cell permeableN
          Peptide ContentY
          Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH₂
          Dimensions
          Materials Information
          Toxicological Information
          Safety Information according to GHS
          Safety Information
          Product Usage Statements
          Storage and Shipping Information
          Ship Code Ambient Temperature Only
          Toxicity Standard Handling
          Storage -20°C
          Hygroscopic Hygroscopic
          Do not freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 6 months at -20°C.
          Packaging Information
          Transport Information
          Supplemental Information
          Specifications

          Documentation

          MSDS

          Title

          Safety Data Sheet (SDS) 

          Certificates of Analysis

          TitleLot Number
          05-23-2151

          References

          Přehled odkazů
          Kobayashi, H., et al. 1994. Brain Res. 647, 145.
          Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027.
          Data Sheet

          Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

          Revision12-May-2008 JSW
          SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂
          DescriptionIncreases cAMP levels in a dose-dependent manner (EC50 = 4.7 nM). Increases tyrosine hydroxylase expression in chromaffin cells.
          FormWhite to off-white solid
          FormulationSupplied as a trifluoroacetate salt.
          CAS number127317-03-7
          Chemical formulaC₁₄₂H₂₂₄N₄₀O₃₉S
          Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH₂
          Purity≥98% by HPLC
          Solubility5% Acetic acid (1 mg/ml)
          Storage -20°C
          Hygroscopic
          Do Not Freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 6 months at -20°C.
          Toxicity Standard Handling
          ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
          Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027.