05-23-2005 Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem

05-23-2005
Price could not be retrieved
Minimum Quantity needs to be mulitiple of
Upon Order Completion More Information
You Saved ()
 
Request Pricing
Limited AvailabilityLimited Availability
In Stock 
Discontinued
Limited Quantities Available
Availability to be confirmed
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service
      Contact Customer Service
      View Pricing & Availability
      Click To Print This Page

      Overview

      Replacement Information

      Key Spec Table

      Empirical FormulaCAS #
      C₁₈₉H₂₈₅N₅₅O₅₇S90880-35-6

      Pricing & Availability

      Catalogue NumberAvailability Packaging Qty/Pack Price Quantity
      05-23-2005-0.5MG
      Retrieving availability...
      Limited AvailabilityLimited Availability
      In Stock 
      Discontinued
      Limited Quantities Available
      Availability to be confirmed
        Remaining : Will advise
          Remaining : Will advise
          Will advise
          Contact Customer Service
          Contact Customer Service

          Glass bottle .5 mg
          Retrieving price...
          Price could not be retrieved
          Minimum Quantity needs to be mulitiple of
          Upon Order Completion More Information
          You Saved ()
           
          Request Pricing
          05-23-2005-1MG
          Retrieving availability...
          Limited AvailabilityLimited Availability
          In Stock 
          Discontinued
          Limited Quantities Available
          Availability to be confirmed
            Remaining : Will advise
              Remaining : Will advise
              Will advise
              Contact Customer Service
              Contact Customer Service

              Plastic ampoule 1 mg
              Retrieving price...
              Price could not be retrieved
              Minimum Quantity needs to be mulitiple of
              Upon Order Completion More Information
              You Saved ()
               
              Request Pricing
              Description
              OverviewA potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells.
              Catalogue Number05-23-2005
              Brand Family Calbiochem®
              SynonymsNPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂
              References
              ReferencesXiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
              Wahlestedt, C., et al. 1993. Science 259, 528.
              Leibowitz, S.F. 1992. NeuroReport 3, 1023.
              Product Information
              CAS number90880-35-6
              ATP CompetitiveN
              FormWhite to off-white lyophilized solid
              FormulationSupplied as trifluoroacetate salt. Sold on the basis of peptide content.
              Hill FormulaC₁₈₉H₂₈₅N₅₅O₅₇S
              Chemical formulaC₁₈₉H₂₈₅N₅₅O₅₇S
              ReversibleY
              Sold on the basis of peptide contentY
              Applications
              Biological Information
              Primary TargetA potent vasoconstrictor
              Purity≥97% by HPLC
              Physicochemical Information
              Cell permeableN
              Peptide ContentY
              Peptide SequenceH-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH₂
              Dimensions
              Materials Information
              Toxicological Information
              Safety Information according to GHS
              Safety Information
              R PhraseR: 20/21/22

              Harmful by inhalation, in contact with skin and if swallowed.
              S PhraseS: 36

              Wear suitable protective clothing.
              Product Usage Statements
              Storage and Shipping Information
              Ship Code Ambient Temperature Only
              Toxicity Harmful
              Storage -20°C
              Protect from Moisture Protect from moisture
              Do not freeze Ok to freeze
              Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
              Packaging Information
              Transport Information
              Supplemental Information
              Specifications

              Documentation

              SDS

              Title

              Safety Data Sheet (SDS) 

              Certificates of Analysis

              TitleLot Number
              05-23-2005

              References

              Reference overview
              Xiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
              Wahlestedt, C., et al. 1993. Science 259, 528.
              Leibowitz, S.F. 1992. NeuroReport 3, 1023.
              Data Sheet

              Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

              Revision18-September-2008 RFH
              SynonymsNPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂
              DescriptionA potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells.
              FormWhite to off-white lyophilized solid
              FormulationSupplied as trifluoroacetate salt. Sold on the basis of peptide content.
              CAS number90880-35-6
              Chemical formulaC₁₈₉H₂₈₅N₅₅O₅₇S
              Peptide SequenceH-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH₂
              Purity≥97% by HPLC
              Solubility5% Acetic acid (1 mg/ml)
              Storage -20°C
              Protect from moisture
              Do Not Freeze Ok to freeze
              Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
              Toxicity Harmful
              Merck USA index14, 6485
              ReferencesXiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
              Wahlestedt, C., et al. 1993. Science 259, 528.
              Leibowitz, S.F. 1992. NeuroReport 3, 1023.