05-23-2005 Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem

05-23-2005
Le prix n'a pas pu être récupéré
La quantité minimale doit être un multiple de
À la validation de la commande Plus d'informations
Vous avez sauvegardé ()
 
Demander le prix
Disponibilité limitéeDisponibilité limitée
En stock 
Interrompu(e)
Disponible en quantités limitées
Disponibilité à confirmer
    Pour le restant : Nous vous tiendrons informé
      Pour le restant : Nous vous tiendrons informé
      Nous vous tiendrons informé
      Contacter le Service Clients
      Contact Customer Service
      Voir les Prix & la Disponibilité
      Click To Print This Page

      Aperçu

      Replacement Information

      Tableau de caractéristiques principal

      Empirical FormulaCAS #
      C₁₈₉H₂₈₅N₅₅O₅₇S 90880-35-6

      Prix & Disponibilité

      RéférenceDisponibilité Conditionnement Qté Prix Quantité
      05-23-2005-0.5MG
      Récupération des données relatives à la disponibilité...
      Disponibilité limitéeDisponibilité limitée
      En stock 
      Interrompu(e)
      Disponible en quantités limitées
      Disponibilité à confirmer
        Pour le restant : Nous vous tiendrons informé
          Pour le restant : Nous vous tiendrons informé
          Nous vous tiendrons informé
          Contacter le Service Clients
          Contact Customer Service

          Flacon en verre .5 mg
          Prix en cours de récupération
          Le prix n'a pas pu être récupéré
          La quantité minimale doit être un multiple de
          À la validation de la commande Plus d'informations
          Vous avez sauvegardé ()
           
          Demander le prix
          05-23-2005-1MG
          Récupération des données relatives à la disponibilité...
          Disponibilité limitéeDisponibilité limitée
          En stock 
          Interrompu(e)
          Disponible en quantités limitées
          Disponibilité à confirmer
            Pour le restant : Nous vous tiendrons informé
              Pour le restant : Nous vous tiendrons informé
              Nous vous tiendrons informé
              Contacter le Service Clients
              Contact Customer Service

              Ampoule plast. 1 mg
              Prix en cours de récupération
              Le prix n'a pas pu être récupéré
              La quantité minimale doit être un multiple de
              À la validation de la commande Plus d'informations
              Vous avez sauvegardé ()
               
              Demander le prix
              Description
              OverviewA potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells.
              Catalogue Number05-23-2005
              Brand Family Calbiochem®
              SynonymsNPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂
              References
              ReferencesXiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
              Wahlestedt, C., et al. 1993. Science 259, 528.
              Leibowitz, S.F. 1992. NeuroReport 3, 1023.
              Product Information
              CAS number90880-35-6
              ATP CompetitiveN
              FormWhite to off-white lyophilized solid
              FormulationSupplied as trifluoroacetate salt. Sold on the basis of peptide content.
              Hill FormulaC₁₈₉H₂₈₅N₅₅O₅₇S
              Chemical formulaC₁₈₉H₂₈₅N₅₅O₅₇S
              ReversibleY
              Sold on the basis of peptide contentY
              Applications
              Biological Information
              Primary TargetA potent vasoconstrictor
              Purity≥97% by HPLC
              Physicochemical Information
              Cell permeableN
              Peptide ContentY
              Peptide SequenceH-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH₂
              Dimensions
              Materials Information
              Toxicological Information
              Safety Information according to GHS
              Safety Information
              R PhraseR: 20/21/22

              Harmful by inhalation, in contact with skin and if swallowed.
              S PhraseS: 36

              Wear suitable protective clothing.
              Product Usage Statements
              Storage and Shipping Information
              Ship Code Ambient Temperature Only
              Toxicity Harmful
              Storage -20°C
              Protect from Moisture Protect from moisture
              Do not freeze Ok to freeze
              Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
              Packaging Information
              Transport Information
              Supplemental Information
              Specifications

              Documentation

              FDS

              Titre

              Fiche de données de sécurité des matériaux (FDS) 

              Certificats d'analyse

              TitreNuméro de lot
              05-23-2005

              Références bibliographiques

              Aperçu de la référence bibliographique
              Xiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
              Wahlestedt, C., et al. 1993. Science 259, 528.
              Leibowitz, S.F. 1992. NeuroReport 3, 1023.
              Fiche technique

              Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

              Revision18-September-2008 RFH
              SynonymsNPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂
              DescriptionA potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells.
              FormWhite to off-white lyophilized solid
              FormulationSupplied as trifluoroacetate salt. Sold on the basis of peptide content.
              CAS number90880-35-6
              Chemical formulaC₁₈₉H₂₈₅N₅₅O₅₇S
              Peptide SequenceH-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH₂
              Purity≥97% by HPLC
              Solubility5% Acetic acid (1 mg/ml)
              Storage -20°C
              Protect from moisture
              Do Not Freeze Ok to freeze
              Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
              Toxicity Harmful
              Merck USA index14, 6485
              ReferencesXiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
              Wahlestedt, C., et al. 1993. Science 259, 528.
              Leibowitz, S.F. 1992. NeuroReport 3, 1023.