05-23-2151 PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem

Le prix n'a pas pu être récupéré
La quantité minimale doit être un multiple de
À la validation de la commande Plus d'informations
Vous avez sauvegardé ()
Demander le prix
Disponibilité limitéeDisponibilité limitée
En stock 
Disponible en quantités limitées
Disponibilité à confirmer
    Pour le restant : Nous vous tiendrons informé
      Pour le restant : Nous vous tiendrons informé
      Nous vous tiendrons informé
      Contacter le Service Clients
      Contact Customer Service
      Voir les Prix & la Disponibilité
      Click To Print This Page


      Replacement Information

      Tableau de caractéristiques principal

      Empirical FormulaCAS #
      C₁₄₂H₂₂₄N₄₀O₃₉S 127317-03-7

      Prix & Disponibilité

      RéférenceDisponibilité Conditionnement Qté Prix Quantité
      Récupération des données relatives à la disponibilité...
      Disponibilité limitéeDisponibilité limitée
      En stock 
      Disponible en quantités limitées
      Disponibilité à confirmer
        Pour le restant : Nous vous tiendrons informé
          Pour le restant : Nous vous tiendrons informé
          Nous vous tiendrons informé
          Contacter le Service Clients
          Contact Customer Service

          Flacon en verre .5 mg
          Prix en cours de récupération
          Le prix n'a pas pu être récupéré
          La quantité minimale doit être un multiple de
          À la validation de la commande Plus d'informations
          Vous avez sauvegardé ()
          Demander le prix
          OverviewIncreases cAMP levels in a dose-dependent manner (EC50 = 4.7 nM). Increases tyrosine hydroxylase expression in chromaffin cells.
          Catalogue Number05-23-2151
          Brand Family Calbiochem®
          SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂
          ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
          Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027.
          Product Information
          CAS number127317-03-7
          ATP CompetitiveN
          FormWhite to off-white solid
          FormulationSupplied as a trifluoroacetate salt.
          Hill FormulaC₁₄₂H₂₂₄N₄₀O₃₉S
          Chemical formulaC₁₄₂H₂₂₄N₄₀O₃₉S
          Hygroscopic Hygroscopic
          Sold on the basis of peptide contentY
          Biological Information
          Primary TargetIncreases cAMP levels
          Primary Target IC<sub>50</sub>EC50 = 4.7 nM increasing cAMP levels in a dose-dependent manner
          Purity≥98% by HPLC
          Physicochemical Information
          Cell permeableN
          Peptide ContentY
          Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH₂
          Materials Information
          Toxicological Information
          Safety Information according to GHS
          Safety Information
          Product Usage Statements
          Storage and Shipping Information
          Ship Code Ambient Temperature Only
          Toxicity Standard Handling
          Storage -20°C
          Hygroscopic Hygroscopic
          Do not freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 6 months at -20°C.
          Packaging Information
          Transport Information
          Supplemental Information




          Fiche de données de sécurité des matériaux (FDS) 

          Certificats d'analyse

          TitreNuméro de lot

          Références bibliographiques

          Aperçu de la référence bibliographique
          Kobayashi, H., et al. 1994. Brain Res. 647, 145.
          Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027.
          Fiche technique

          Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

          Revision12-May-2008 JSW
          SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂
          DescriptionIncreases cAMP levels in a dose-dependent manner (EC50 = 4.7 nM). Increases tyrosine hydroxylase expression in chromaffin cells.
          FormWhite to off-white solid
          FormulationSupplied as a trifluoroacetate salt.
          CAS number127317-03-7
          Chemical formulaC₁₄₂H₂₂₄N₄₀O₃₉S
          Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH₂
          Purity≥98% by HPLC
          Solubility5% Acetic acid (1 mg/ml)
          Storage -20°C
          Do Not Freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 6 months at -20°C.
          Toxicity Standard Handling
          ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
          Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027.