05-23-2150 PACAP 38, Ovine - CAS 137061-48-4 - Calbiochem

Le prix n'a pas pu être récupéré
La quantité minimale doit être un multiple de
À la validation de la commande Plus d'informations
Vous avez sauvegardé ()
Demander le prix
Disponibilité limitéeDisponibilité limitée
En stock 
Disponible en quantités limitées
Disponibilité à confirmer
    Pour le restant : Nous vous tiendrons informé
      Pour le restant : Nous vous tiendrons informé
      Nous vous tiendrons informé
      Contacter le Service Clients
      Contact Customer Service
      Voir les Prix & la Disponibilité
      Click To Print This Page


      Replacement Information

      Tableau de caractéristiques principal

      Empirical FormulaCAS #
      C₂₀₃H₃₃₁N₆₃O₅₃S 137061-48-4

      Prix & Disponibilité

      RéférenceDisponibilité Conditionnement Qté Prix Quantité
      Récupération des données relatives à la disponibilité...
      Disponibilité limitéeDisponibilité limitée
      En stock 
      Disponible en quantités limitées
      Disponibilité à confirmer
        Pour le restant : Nous vous tiendrons informé
          Pour le restant : Nous vous tiendrons informé
          Nous vous tiendrons informé
          Contacter le Service Clients
          Contact Customer Service

          Ampoule plast. .1 mg
          Prix en cours de récupération
          Le prix n'a pas pu être récupéré
          La quantité minimale doit être un multiple de
          À la validation de la commande Plus d'informations
          Vous avez sauvegardé ()
          Demander le prix
          Récupération des données relatives à la disponibilité...
          Disponibilité limitéeDisponibilité limitée
          En stock 
          Disponible en quantités limitées
          Disponibilité à confirmer
            Pour le restant : Nous vous tiendrons informé
              Pour le restant : Nous vous tiendrons informé
              Nous vous tiendrons informé
              Contacter le Service Clients
              Contact Customer Service

              Ampoule plast. 1 mg
              Prix en cours de récupération
              Le prix n'a pas pu être récupéré
              La quantité minimale doit être un multiple de
              À la validation de la commande Plus d'informations
              Vous avez sauvegardé ()
              Demander le prix
              OverviewMore active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50 = 7 nM).
              Catalogue Number05-23-2150
              Brand Family Calbiochem®
              SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
              ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
              Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
              Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
              Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.
              Product Information
              CAS number137061-48-4
              ATP CompetitiveN
              FormWhite to off-white solid
              Hill FormulaC₂₀₃H₃₃₁N₆₃O₅₃S
              Chemical formulaC₂₀₃H₃₃₁N₆₃O₅₃S
              Hygroscopic Hygroscopic
              Sold on the basis of peptide contentY
              Biological Information
              Primary TargetAdenylate cyclase
              Primary Target IC<sub>50</sub>EC50 = 7 nM against adenylate cyclase
              Purity≥96% by HPLC
              Physicochemical Information
              Cell permeableN
              Peptide ContentY
              Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂
              Materials Information
              Toxicological Information
              Safety Information according to GHS
              Safety Information
              Product Usage Statements
              Storage and Shipping Information
              Ship Code Ambient Temperature Only
              Toxicity Standard Handling
              Storage -20°C
              Hygroscopic Hygroscopic
              Do not freeze Ok to freeze
              Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
              Packaging Information
              Transport Information
              Supplemental Information




              Fiche de données de sécurité des matériaux (FDS) 

              Certificats d'analyse

              TitreNuméro de lot

              Références bibliographiques

              Aperçu de la référence bibliographique
              Kobayashi, H., et al. 1994. Brain Res. 647, 145.
              Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
              Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
              Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.
              Fiche technique

              Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

              Revision12-May-2008 JSW
              SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
              DescriptionMore active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50 = 7 nM).
              FormWhite to off-white solid
              CAS number137061-48-4
              Chemical formulaC₂₀₃H₃₃₁N₆₃O₅₃S
              Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂
              Purity≥96% by HPLC
              Solubility5% Acetic Acid (1 mg/ml)
              Storage -20°C
              Do Not Freeze Ok to freeze
              Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
              Toxicity Standard Handling
              ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
              Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
              Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
              Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.