05-23-0930 | β-Endorphin, Human

05-23-0930
  
Az ár letöltése folyamatban...
Az ár nem tölthető be
Minimum Quantity needs to be mulitiple of
Megrendelés befejezésekor További információ
Elmentette a ()-t
 
Árajánlat kérése
Korlátozott elérhetőségKorlátozott elérhetőség
Készleten 
Megszűnt
Korlátozott mennyiségben elérhető
Az elérhetőség megerősítésre vár
    Remaining : Will advise
      Remaining : Will advise
      Tanácsadás
      Lépjen kapcsolatba a vevőszolgálattal

       

      Lépjen kapcsolatba a vevőszolgálattal

      Kattintson az oldal kinyomtatásához

      Áttekintés

      Replacement Information

      Kulcsspecifikációk táblázata

      Empirical FormulaCAS #
      C₁₅₈H₂₅₁N₃₉O₄₆S 61214-51-5
      Description
      Overview

      This product has been discontinued.

      We apologize for the inconvenience, but we do not currently have an alternative product.





      Neurohormone secreted by the pituitary gland. The most potent of the opioid peptides. More effective than morphine in tests of opioid receptor binding, analgesia, and catatonia. High doses cause rigidity and hypothermia in rats.
      Catalogue Number05-23-0930
      Brand Family Calbiochem®
      Synonymsβ-Lipoprotein 61-91, Human, YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
      References
      ReferencesDalayeun, J.F., et al. 1993. Biomed. Pharmacother. 47, 311.
      Akil, H., et al. 1984. Annu. Rev. Neurosci. 7, 223.
      Product Information
      CAS number61214-51-5
      FormWhite to off-white lyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      Hill FormulaC₁₅₈H₂₅₁N₃₉O₄₆S
      Chemical formulaC₁₅₈H₂₅₁N₃₉O₄₆S
      Hygroscopic Hygroscopic
      Sold on the basis of peptide contentY
      Applications
      Biological Information
      Purity≥95% by HPLC
      Physicochemical Information
      Peptide ContentY
      Peptide SequenceH-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu-OH
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      RTECSJZ1650000
      Safety Information
      R PhraseR: 20/21/22

      Harmful by inhalation, in contact with skin and if swallowed.
      S PhraseS: 36

      Wear suitable protective clothing.
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Ambient Temperature Only
      Toxicity Harmful
      Storage -20°C
      Protect from Moisture Protect from moisture
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Packaging Information
      Transport Information
      Supplemental Information
      Specifications

      Documentation

      MSDS

      Title

      Safety Data Sheet (SDS) 

      Certificates of Analysis

      TitleLot Number
      05-23-0930

      References

      Hivatkozások áttekintése
      Dalayeun, J.F., et al. 1993. Biomed. Pharmacother. 47, 311.
      Akil, H., et al. 1984. Annu. Rev. Neurosci. 7, 223.
      Data Sheet

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision18-September-2008 RFH
      Synonymsβ-Lipoprotein 61-91, Human, YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
      DescriptionNeurohormone secreted by the pituitary gland. The most potent of the opiate peptides. More effective than morphine in tests of opiate receptor binding, analgesia, and catatonia. High doses cause rigidity and hypothermia in rats.
      FormWhite to off-white lyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      CAS number61214-51-5
      RTECSJZ1650000
      Chemical formulaC₁₅₈H₂₅₁N₃₉O₄₆S
      Peptide SequenceH-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu-OH
      Purity≥95% by HPLC
      Solubility5% Acetic acid (1 mg/ml)
      Storage -20°C
      Hygroscopic
      Protect from moisture
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Toxicity Harmful
      Merck USA index14, 3572
      ReferencesDalayeun, J.F., et al. 1993. Biomed. Pharmacother. 47, 311.
      Akil, H., et al. 1984. Annu. Rev. Neurosci. 7, 223.