05-23-2150 PACAP 38, Ovine - CAS 137061-48-4 - Calbiochem

Az ár nem tölthető be
Minimum Quantity needs to be mulitiple of
Megrendelés befejezésekor További információ
Elmentette a ()-t
Árajánlat kérése
Korlátozott elérhetőségKorlátozott elérhetőség
Korlátozott mennyiségben elérhető
Az elérhetőség megerősítésre vár
    Remaining : Will advise
      Remaining : Will advise
      Lépjen kapcsolatba a vevőszolgálattal
      Contact Customer Service
      Árak és elérhetőség megtekintése
      Kattintson az oldal kinyomtatásához


      Replacement Information

      Kulcsspecifikációk táblázata

      Empirical FormulaCAS #
      C₂₀₃H₃₃₁N₆₃O₅₃S 137061-48-4

      Árak és elérhetőség

      KatalógusszámElérhetőség Csomagolás Menny./csomag Ár Mennyiség
      Elérhetőség betöltése...
      Korlátozott elérhetőségKorlátozott elérhetőség
      Korlátozott mennyiségben elérhető
      Az elérhetőség megerősítésre vár
        Remaining : Will advise
          Remaining : Will advise
          Lépjen kapcsolatba a vevőszolgálattal
          Contact Customer Service

          Muanyagampulla .1 mg
          Az ár letöltése folyamatban...
          Az ár nem tölthető be
          Minimum Quantity needs to be mulitiple of
          Megrendelés befejezésekor További információ
          Elmentette a ()-t
          Árajánlat kérése
          Elérhetőség betöltése...
          Korlátozott elérhetőségKorlátozott elérhetőség
          Korlátozott mennyiségben elérhető
          Az elérhetőség megerősítésre vár
            Remaining : Will advise
              Remaining : Will advise
              Lépjen kapcsolatba a vevőszolgálattal
              Contact Customer Service

              Muanyagampulla 1 mg
              Az ár letöltése folyamatban...
              Az ár nem tölthető be
              Minimum Quantity needs to be mulitiple of
              Megrendelés befejezésekor További információ
              Elmentette a ()-t
              Árajánlat kérése
              OverviewMore active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50 = 7 nM).
              Catalogue Number05-23-2150
              Brand Family Calbiochem®
              SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
              ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
              Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
              Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
              Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.
              Product Information
              CAS number137061-48-4
              ATP CompetitiveN
              FormWhite to off-white solid
              Hill FormulaC₂₀₃H₃₃₁N₆₃O₅₃S
              Chemical formulaC₂₀₃H₃₃₁N₆₃O₅₃S
              Hygroscopic Hygroscopic
              Sold on the basis of peptide contentY
              Biological Information
              Primary TargetAdenylate cyclase
              Primary Target IC<sub>50</sub>EC50 = 7 nM against adenylate cyclase
              Purity≥96% by HPLC
              Physicochemical Information
              Cell permeableN
              Peptide ContentY
              Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂
              Materials Information
              Toxicological Information
              Safety Information according to GHS
              Safety Information
              Product Usage Statements
              Storage and Shipping Information
              Ship Code Ambient Temperature Only
              Toxicity Standard Handling
              Storage -20°C
              Hygroscopic Hygroscopic
              Do not freeze Ok to freeze
              Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
              Packaging Information
              Transport Information
              Supplemental Information




              Safety Data Sheet (SDS) 

              Certificates of Analysis

              TitleLot Number


              Hivatkozások áttekintése
              Kobayashi, H., et al. 1994. Brain Res. 647, 145.
              Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
              Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
              Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.
              Data Sheet

              Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

              Revision12-May-2008 JSW
              SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
              DescriptionMore active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50 = 7 nM).
              FormWhite to off-white solid
              CAS number137061-48-4
              Chemical formulaC₂₀₃H₃₃₁N₆₃O₅₃S
              Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂
              Purity≥96% by HPLC
              Solubility5% Acetic Acid (1 mg/ml)
              Storage -20°C
              Do Not Freeze Ok to freeze
              Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
              Toxicity Standard Handling
              ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
              Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
              Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
              Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.