05-23-2150 | PACAP 38, Ovine - CAS 137061-48-4 - Calbiochem

05-23-2150
Az ár nem tölthető be
Minimum Quantity needs to be mulitiple of
Megrendelés befejezésekor További információ
Elmentette a ()-t
 
Árajánlat kérése
Korlátozott elérhetőségKorlátozott elérhetőség
Készleten 
Megszűnt
Korlátozott mennyiségben elérhető
Az elérhetőség megerősítésre vár
    Remaining : Will advise
      Remaining : Will advise
      Tanácsadás
      Lépjen kapcsolatba a vevőszolgálattal
      Árak és elérhetőség megtekintése
      Kattintson az oldal kinyomtatásához

      Áttekintés

      Replacement Information

      Kulcsspecifikációk táblázata

      Empirical FormulaCAS #
      C₂₀₃H₃₃₁N₆₃O₅₃S 137061-48-4

      Árak és elérhetőség

      KatalógusszámElérhetőség Csomagolás Menny./csomag Ár Mennyiség
      05-23-2150-0.1MG
      Elérhetőség betöltése...
      Korlátozott elérhetőségKorlátozott elérhetőség
      Készleten 
      Megszűnt
      Korlátozott mennyiségben elérhető
      Az elérhetőség megerősítésre vár
        Remaining : Will advise
          Remaining : Will advise
          Tanácsadás
          Lépjen kapcsolatba a vevőszolgálattal

          Muanyagampulla .1 mg
          Az ár letöltése folyamatban...
          Az ár nem tölthető be
          Minimum Quantity needs to be mulitiple of
          Megrendelés befejezésekor További információ
          Elmentette a ()-t
           
          Árajánlat kérése
          05-23-2150-1MG
          Elérhetőség betöltése...
          Korlátozott elérhetőségKorlátozott elérhetőség
          Készleten 
          Megszűnt
          Korlátozott mennyiségben elérhető
          Az elérhetőség megerősítésre vár
            Remaining : Will advise
              Remaining : Will advise
              Tanácsadás
              Lépjen kapcsolatba a vevőszolgálattal

              Muanyagampulla 1 mg
              Az ár letöltése folyamatban...
              Az ár nem tölthető be
              Minimum Quantity needs to be mulitiple of
              Megrendelés befejezésekor További információ
              Elmentette a ()-t
               
              Árajánlat kérése
              Description
              OverviewMore active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50 = 7 nM).
              Catalogue Number05-23-2150
              Brand Family Calbiochem®
              SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
              References
              ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
              Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
              Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
              Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.
              Product Information
              CAS number137061-48-4
              ATP CompetitiveN
              FormWhite to off-white solid
              Hill FormulaC₂₀₃H₃₃₁N₆₃O₅₃S
              Chemical formulaC₂₀₃H₃₃₁N₆₃O₅₃S
              Hygroscopic Hygroscopic
              ReversibleN
              Sold on the basis of peptide contentY
              Applications
              Biological Information
              Primary TargetAdenylate cyclase
              Primary Target IC<sub>50</sub>EC50 = 7 nM against adenylate cyclase
              Purity≥96% by HPLC
              Physicochemical Information
              Cell permeableN
              Peptide ContentY
              Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂
              Dimensions
              Materials Information
              Toxicological Information
              Safety Information according to GHS
              Safety Information
              Product Usage Statements
              Storage and Shipping Information
              Ship Code Ambient Temperature Only
              Toxicity Standard Handling
              Storage -20°C
              Hygroscopic Hygroscopic
              Do not freeze Ok to freeze
              Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
              Packaging Information
              Transport Information
              Supplemental Information
              Specifications

              Documentation

              MSDS

              Title

              Safety Data Sheet (SDS) 

              Certificates of Analysis

              TitleLot Number
              05-23-2150

              References

              Hivatkozások áttekintése
              Kobayashi, H., et al. 1994. Brain Res. 647, 145.
              Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
              Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
              Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.
              Data Sheet

              Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

              Revision12-May-2008 JSW
              SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
              DescriptionMore active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50 = 7 nM).
              FormWhite to off-white solid
              CAS number137061-48-4
              Chemical formulaC₂₀₃H₃₃₁N₆₃O₅₃S
              Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂
              Purity≥96% by HPLC
              Solubility5% Acetic Acid (1 mg/ml)
              Storage -20°C
              Hygroscopic
              Do Not Freeze Ok to freeze
              Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
              Toxicity Standard Handling
              ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
              Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
              Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
              Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.