06-847 | Anti-EGFR Antibody

06-847
200 µg  
Retrieving price...
Price could not be retrieved
Minimum Quantity needs to be mulitiple of
Upon Order Completion More Information
You Saved ()
 
Request Pricing
Limited AvailabilityLimited Availability
In Stock 
Discontinued
Limited Quantities Available
Availability to be confirmed
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service

      Special Offers

       

      Contact Customer Service

      Click To Print This Page

      Overview

      Replacement Information

      Key Spec Table

      Species ReactivityKey ApplicationsHostFormatAntibody Type
      H, M, R, HtIP, WBRbPurifiedPolyclonal Antibody
      Description
      Catalogue Number06-847
      Replaces04-337; 04-338
      Brand Family Upstate
      Trade Name
      • Upstate
      DescriptionAnti-EGFR Antibody
      Alternate Names
      • Receptor tyrosine-protein kinase ErbB-1
      • avian erythroblastic leukemia viral (v-erb-b) oncogene homolog
      • cell growth inhibiting protein 40
      • cell proliferation-inducing protein 61
      • epidermal growth factor receptor
      • epidermal growth factor receptor (avian erythroblastic leukemia viral
        (v-erb-b) oncogene homolog)
      • epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian)
      Background InformationThe epidermal growth factor receptor (EGFR; ErbB-1; HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. The epidermal growth factor receptor is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: EGFR (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4). Mutations affecting EGFR expression or activity could result in cancer. EGFR (epidermal growth factor receptor) exists on the cell surface and is activated by binding of its specific ligands, including epidermal growth factor and transforming growth factor α (TGFα). Upon activation by its growth factor ligands, EGFR undergoes a transition from an inactive monomeric form to an active homodimer. In addition to forming homodimers after ligand binding, EGFR may pair with another member of the ErbB receptor family, such as ErbB2/Her2/neu, to create an activated heterodimer. EGFR dimerization stimulates its intrinsic intracellular protein-tyrosine kinase activity. As a result, autophosphorylation of five tyrosine (Y) residues in the C-terminal domain of EGFR occurs.
      References
      Product Information
      FormatPurified
      Control
      • A431 cell lysate, human cervical carcinoma.

        Included Positive Antigen Control:
        Catalog # 12-305, 3T3/A31 Cell Lysate. Add 2.5 µL of 2-mercaptoethanol/100 µL of lysate and boil for 5 minutes to reduce the preparation. Load 20 µg of reduced lysate per lane for minigels.
      PresentationPurified rabbit polyclonal IgG in buffer containing 0.1M Tris-Glycine, 0.15M NaCl, 0.05% Sodium Azide, pH 7.4. Store at 2-8°C.
      Applications
      ApplicationAnti-EGFR Antibody detects level of EGFR & has been published & validated for use in IP & WB.
      Key Applications
      • Immunoprecipitation
      • Western Blotting
      Application NotesImmunoprecipitation:
      4 µg of a previous lot immunoprecipitated the EGFR from 500 µg of a 3T3/A31 RIPA cell lysate.
      Biological Information
      ImmunogenOvalbumin conjugated synthetic peptide (ETKPNGIFKGPTAENAEYLRVAPPSSEFIGA) corresponding to amino acids 1156-1186 of the processed mouse EGF receptor (EGFR) C-terminal domain (Accession number Q01279). The immunizing sequence shares 28/31 identity with the human EGF receptor sequence.
      ConcentrationPlease refer to the Certificate of Analysis for the lot-specific concentration.
      HostRabbit
      SpecificityRecognizes the EGFR, Mr 180 kDa.
      IsotypeIgG
      Species Reactivity
      • Human
      • Mouse
      • Rat
      • Hamster
      Species Reactivity NoteMouse and human. Reported to detect rat and hamster.
      Antibody TypePolyclonal Antibody
      Entrez Gene Number
      Entrez Gene SummaryThe protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. Mutations in this gene are associated with lung cancer. [provided by RefSeq]
      Gene Symbol
      • EGFR
      • ERBB1
      • ERBB
      • mENA
      Purification MethodProtein A chromatography
      UniProt Number
      UniProt SummaryFUNCTION: SwissProt: P00533 # Isoform 2/truncated isoform may act as an antagonist.
      SIZE: 1210 amino acids; 134277 Da
      SUBUNIT: Binds RIPK1. CBL interacts with the autophosphorylated C- terminal tail of the EGF receptor. Part of a complex with ERBB2 and either PIK3C2A or PIK3C2B. The autophosphorylated form interacts with PIK3C2B, maybe indirectly. Interacts with PELP1.
      SUBCELLULAR LOCATION: Cell membrane; Single-pass type I membrane protein. & Isoform 2: Secreted.
      TISSUE SPECIFICITY: Expressed in placenta. Isoform 2 is also expressed in ovarian cancers.
      PTM: Phosphorylation of Ser-695 is partial and occurs only if Thr- 693 is phosphorylated. & Monoubiquitinated and polyubiquitinated upon EGF stimulation; which does not affect tyrosine kinase activity or signaling capacity but may play a role in lysosomal targeting. Polyubiquitin linkage is mainly through 'Lys-63', but linkage through 'Lys-48', 'Lys-11' and 'Lys-29' also occur.DISEASE:SwissProt: P00533 # Defects in EGFR are associated with lung cancer [MIM:211980].
      SIMILARITY: SwissProt: P00533 ## Belongs to the protein kinase superfamily. Tyr protein kinase family. EGF receptor subfamily. & Contains 1 protein kinase domain.
      MISCELLANEOUS: Binding of EGF to the receptor leads to dimerization, internalization of the EGF-receptor complex, induction of the tyrosine kinase activity, stimulation of cell DNA synthesis, and cell proliferation.
      Molecular Weight180 kDa
      Physicochemical Information
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Quality AssuranceRoutinely evaluated by western blot on a mouse 3T3/A31 RIPA cell lysate.

      Western Blot Analysis:
      0.5-2 µg/mL of this lot detected the EGFR from a mouse 3T3/A31 RIPA cell lysate.
      Usage Statement
      • Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
      Storage and Shipping Information
      Storage ConditionsStable for 1 year at 2-8°C from date of receipt.

      Handling Recommendations: Upon first thaw,
      and prior to removing the cap, centrifuge the
      vial and gently mix the solution.
      Packaging Information
      Material Size200 µg
      Transport Information
      Supplemental Information
      Specifications

      Documentation

      SDS

      Title

      Safety Data Sheet (SDS) 

      Certificates of Analysis

      TitleLot Number
      Anti-EGFR - 2395760 2395760
      Anti-EGFR - 2455633 2455633
      Anti-EGFR - 17163 17163
      Anti-EGFR - 2020912 2020912
      Anti-EGFR - 2066054 2066054
      Anti-EGFR - 2089511 2089511
      Anti-EGFR - 21376 21376
      Anti-EGFR - 2193153 2193153
      Anti-EGFR - 2324564 2324564
      Anti-EGFR - 23971 23971

      References

      Reference overviewApplicationPub Med ID
      A leak pathway for luminal protons in endosomes drives oncogenic signalling in glioblastoma.
      Kondapalli, KC; Llongueras, JP; Capilla-González, V; Prasad, H; Hack, A; Smith, C; Guerrero-Cázares, H; Quiñones-Hinojosa, A; Rao, R
      Nature communications  6  6289  2015

      Show Abstract
      25662504 25662504
      Preclinical pharmacokinetics, pharmacodynamics, and efficacy of RG7116: a novel humanized, glycoengineered anti-HER3 antibody.
      Meneses-Lorente, G; Friess, T; Kolm, I; Hölzlwimmer, G; Bader, S; Meille, C; Thomas, M; Bossenmaier, B
      Cancer chemotherapy and pharmacology  75  837-50  2015

      Show Abstract
      25702049 25702049
      Regulation of fibroblast growth factor-inducible 14 (Fn14) expression levels via ligand-independent lysosomal degradation.
      Gurunathan, S; Winkles, JA; Ghosh, S; Hayden, MS
      The Journal of biological chemistry  289  12976-88  2014

      Show Abstract
      24652288 24652288
      Constitutive and ligand-induced EGFR signalling triggers distinct and mutually exclusive downstream signalling networks.
      Chakraborty, S; Li, L; Puliyappadamba, VT; Guo, G; Hatanpaa, KJ; Mickey, B; Souza, RF; Vo, P; Herz, J; Chen, MR; Boothman, DA; Pandita, TK; Wang, DH; Sen, GC; Habib, AA
      Nature communications  5  5811  2014

      Show Abstract
      25503978 25503978
      Malignant peripheral nerve sheath tumor invasion requires aberrantly expressed EGF receptors and is variably enhanced by multiple EGF family ligands.
      Byer, SJ; Brossier, NM; Peavler, LT; Eckert, JM; Watkins, S; Roth, KA; Carroll, SL
      Journal of neuropathology and experimental neurology  72  219-33  2013

      Show Abstract
      Western Blotting23399900 23399900
      The role of MMP-1 in breast cancer growth and metastasis to the brain in a xenograft model.
      Liu, H; Kato, Y; Erzinger, SA; Kiriakova, GM; Qian, Y; Palmieri, D; Steeg, PS; Price, JE
      BMC cancer  12  583  2012

      Show Abstract
      Western Blotting23217186 23217186
      Regulated intramembrane cleavage of the EGF receptor.
      Hong-Jun Liao,Graham Carpenter
      Traffic (Copenhagen, Denmark)  13  2012

      Show Abstract
      22531034 22531034
      Nonmuscle Myosin II Is Required for Internalization of the Epidermal Growth Factor Receptor and Modulation of Downstream Signaling.
      Jong Hyun Kim,Aibing Wang,Mary Anne Conti,Robert S Adelstein
      The Journal of biological chemistry  287  2012

      Show Abstract
      22718763 22718763
      Frank-ter Haar Syndrome Protein Tks4 Regulates Epidermal Growth Factor-dependent Cell Migration.
      G B,Annam Gujd,Mikl Geiszt,Arp L,Anna Fekete,Szabolcs Sipeki,Julian Downward,L Buday,Gábor Bögel,Annamária Gujdár,Miklós Geiszt,Arpád Lányi,László Buday
      The Journal of biological chemistry  287  2012

      Show Abstract
      22829589 22829589
      Epidermal growth factor receptor-targeted photosensitizer selectively inhibits EGFR signaling and induces targeted phototoxicity in ovarian cancer cells.
      Abu-Yousif, AO; Moor, AC; Zheng, X; Savellano, MD; Yu, W; Selbo, PK; Hasan, T
      Cancer letters  321  120-7  2012

      Show Abstract
      22266098 22266098

      Brochure

      Title
      Product Selection Guide - Antibodies, small molecule inhibitors, kits, assays and proteins for signaling research.

      Related Products & Applications

      Related Products

      Included Positive Control

      Catalogue Number Description  
      12-305 3T3/A31 Cell Lysate Show Pricing & Availability

      Product Families

      Categories

      Life Science Research > Antibodies and Assays > Primary Antibodies