06-182 | Anti-MAP Kinase 1/2 (Erk1/2) Antibody, CT

06-182
100 µg  
Retrieving price...
Price could not be retrieved
Minimum Quantity needs to be mulitiple of
Upon Order Completion More Information
You Saved ()
 
Request Pricing
Limited AvailabilityLimited Availability
In Stock 
Discontinued
Limited Quantities Available
Availability to be confirmed
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service

      Special Offers

       

      Contact Customer Service

      Click To Print This Page

      Overview

      Replacement Information
      Replacement InformationThe recommended replacement for this product is Cat. No. ABS44

      Key Spec Table

      Species ReactivityKey ApplicationsHostFormatAntibody Type
      Av, H, M, R, Sh, Xn, EchICC, IP, WBRbAffinity PurifiedPolyclonal Antibody
      Description
      Catalogue Number06-182
      Brand Family Upstate
      Trade Name
      • Upstate
      DescriptionAnti-MAP Kinase 1/2 (Erk1/2) Antibody, CT
      Background InformationThe extracellular signal-regulated kinases 1 and 2 (ERK1 and ERK2), also called p44 and p42 MAP kinases, are members of the Mitogen Activated Protein Kinase (MAPK) family of proteins found in all eukaryotes. Because the 44 kDa ERK1 and the 42 kDa ERK2 are highly homologous and both function in the same protein kinase cascade, the two proteins are often referred to collectively as ERK1/2 or p44/p42 MAP kinase. The ERK1/2 signaling cascade has been shown to be a critical regulator of cell differentiation, cell physiology and neuronal function. Aberrant control of ERK1/2 activity has been implicated in a variety of pathological conditions, including cancer and autoimmune diseases, and efficient study methods are in demand.
      References
      Product Information
      FormatAffinity Purified
      Control
      • Positive Control Included: 3T3 Cell Lysate (12-305)
      PresentationImmunoaffinity purified immunoglobulin in 0.07M Tris-glycine, pH 7.4, 0.105 M NaCl, 0.035% sodium azide as a preservative.
      Applications
      ApplicationAnti-MAP Kinase 1/2 (Erk1/2) Antibody, CT detects level of MAP Kinase 1/2 (Erk1/2) & has been published & validated for use in IC, IP & WB.
      Key Applications
      • Immunocytochemistry
      • Immunoprecipitation
      • Western Blotting
      Biological Information
      Immunogen38 residue synthetic peptide (CGGPFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to the C-terminal 35 amino acids of the rat 44kDa MAP Kinase 2/Erk2
      ConcentrationPlease refer to the Certificate of Analysis for the lot-specific concentration.
      HostRabbit
      SpecificityRecognizes MAPK1/Erk1 and MAPK2/Erk2.
      IsotypeIgG
      Species Reactivity
      • Avian
      • Human
      • Mouse
      • Rat
      • Sheep
      • Xenopus
      • Echinoderms
      Antibody TypePolyclonal Antibody
      Entrez Gene Number
      Entrez Gene SummaryThe protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene.
      Gene Symbol
      • MAPK1
      • p38
      • ERK
      • P42MAPK
      • ERK2
      • p40
      • PRKM1
      • p41mapk
      • PRKM2
      • MAPK2
      • p42-MAPK
      • p41
      • ERK-2
      • ERT1
      Purification MethodImmunoAffinity Purified
      UniProt Number
      UniProt SummaryFUNCTION: SwissProt: P28482 # Involved in both the initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors such as ELK1. Phosphorylates EIF4EBP1; required for initiation of translation. Phosphorylates microtubule-associated protein 2 (MAP2). Phosphorylates SPZ1 (By similarity). Phosphorylates heat shock factor protein 4 (HSF4).
      COFACTOR: Magnesium (By similarity).
      SIZE: 360 amino acids; 41390 Da
      SUBUNIT: Interacts with MORG1 (By similarity). Binds to HIV-1 Nef through its SH3 domain. This interaction inhibits its tyrosine- kinase activity. Interacts with HSF4.
      DOMAIN: SwissProt: P28482 The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.
      PTM: Dually phosphorylated on Thr-185 and Tyr-187, which activates the enzyme.
      SIMILARITY: Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily. & Contains 1 protein kinase domain.
      Molecular WeightMAPK1/Erk1 (44 kDa) and MAPK2/Erk2 (42 kDa)
      Physicochemical Information
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Quality Assuranceroutinely evaluated by immunoblot on mouse 3T3/A31 fibroblasts, rat L6 cells or human A431 carcinoma cells
      Usage Statement
      • Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
      Storage and Shipping Information
      Storage ConditionsMaintain for 1 year at -20°C from date of shipment. Aliquot to avoid repeated freezing and thawing. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
      Packaging Information
      Material Size100 µg
      Transport Information
      Supplemental Information
      Specifications

      Documentation

      SDS

      Title

      Safety Data Sheet (SDS) 

      Certificates of Analysis

      TitleLot Number
      Anti-MAP Kinase 1/2 (Erk1/2), CT 2475693
      Anti-MAP Kinase 1/2 (Erk1/2), CT - 2137081 2137081
      Anti-MAP Kinase 1/2 (Erk1/2), CT - 2379354 2379354
      Anti-MAP Kinase 1/2 (Erk1/2), CT - 2430422 2430422
      Anti-MAP Kinase 1/2 (Erk1/2), CT - 2455586 2455586
      Anti-MAP Kinase 1/2 (Erk1/2), CT - 2459609 2459609
      Anti-MAP Kinase 1/2 (Erk1/2), CT - 1350552 1350552
      Anti-MAP Kinase 1/2 (Erk1/2), CT - 16190 16190
      Anti-MAP Kinase 1/2 (Erk1/2), CT - 16769 16769
      Anti-MAP Kinase 1/2 (Erk1/2), CT - 18082 18082

      References

      Reference overviewApplicationSpeciesPub Med ID
      Characterization of Aldh2 (-/-) mice as an age-related model of cognitive impairment and Alzheimer's disease.
      D'Souza, Y; Elharram, A; Soon-Shiong, R; Andrew, RD; Bennett, BM
      Molecular brain  8  27  2015

      Show Abstract
      25910195 25910195
      High EMT Signature Score of Invasive Non-Small Cell Lung Cancer (NSCLC) Cells Correlates with NFκB Driven Colony-Stimulating Factor 2 (CSF2/GM-CSF) Secretion by Neighboring Stromal Fibroblasts.
      Rudisch, A; Dewhurst, MR; Horga, LG; Kramer, N; Harrer, N; Dong, M; van der Kuip, H; Wernitznig, A; Bernthaler, A; Dolznig, H; Sommergruber, W
      PloS one  10  e0124283  2015

      Show Abstract
      25919140 25919140
      Proximity-dependent initiation of hybridization chain reaction.
      Koos, B; Cane, G; Grannas, K; Löf, L; Arngården, L; Heldin, J; Clausson, CM; Klaesson, A; Hirvonen, MK; de Oliveira, FM; Talibov, VO; Pham, NT; Auer, M; Danielson, UH; Haybaeck, J; Kamali-Moghaddam, M; Söderberg, O
      Nature communications  6  7294  2015

      Show Abstract
      26065580 26065580
      MicroRNA-132 enhances transition from inflammation to proliferation during wound healing.
      Li, D; Wang, A; Liu, X; Meisgen, F; Grünler, J; Botusan, IR; Narayanan, S; Erikci, E; Li, X; Blomqvist, L; Du, L; Pivarcsi, A; Sonkoly, E; Chowdhury, K; Catrina, SB; Ståhle, M; Landén, NX
      The Journal of clinical investigation  125  3008-26  2015

      Show Abstract
      26121747 26121747
      Capillary Isoelectric Focusing Immunoassay for Fat Cell Differentiation Proteomics.
      Johlfs, MG; Gorjala, P; Urasaki, Y; Le, TT; Fiscus, RR
      PloS one  10  e0132105  2015

      Show Abstract
      26132171 26132171
      NMDA receptor- and ERK-dependent histone methylation changes in the lateral amygdala bidirectionally regulate fear memory formation.
      Gupta-Agarwal, S; Jarome, TJ; Fernandez, J; Lubin, FD
      Learning & memory (Cold Spring Harbor, N.Y.)  21  351-62  2014

      Show Abstract
      24939839 24939839
      Paradoxical results in perturbation-based signaling network reconstruction.
      Prabakaran, S; Gunawardena, J; Sontag, E
      Biophysical journal  106  2720-8  2014

      Show Abstract
      24940789 24940789
      Aspirin inhibits cell viability and mTOR downstream signaling in gastroenteropancreatic and bronchopulmonary neuroendocrine tumor cells.
      Spampatti, M; Vlotides, G; Spöttl, G; Maurer, J; Göke, B; Auernhammer, CJ
      World journal of gastroenterology  20  10038-49  2014

      Show Abstract
      Western Blotting25110431 25110431
      The mouse cyclophosphamide model of bladder pain syndrome: tissue characterization, immune profiling, and relationship to metabotropic glutamate receptors.
      Golubeva, AV; Zhdanov, AV; Mallel, G; Dinan, TG; Cryan, JF
      Physiological reports  2  e00260  2014

      Show Abstract
      Western Blotting24760514 24760514
      Distinct antifibrogenic effects of erlotinib, sunitinib and sorafenib on rat pancreatic stellate cells.
      Elsner, A; Lange, F; Fitzner, B; Heuschkel, M; Krause, BJ; Jaster, R
      World journal of gastroenterology  20  7914-25  2014

      Show Abstract
      Western Blotting24976727 24976727

      Brochure

      Title
      Western Blotting Tools

      Technical Info

      Title
      Protein Blotting Handbook: 6th Edition

      Related Products & Applications

      Related Products

      Catalogue Number Description  
      04-349 Anti-MAP Kinase 2/Erk2 Antibody, clone E460, rabbit monoclonal Show Pricing & Availability
      04-797 Anti-phospho-MAP Kinase 1/2 (Erk1/2)(Thr185/Tyr187) Antibody, clone AW39 Show Pricing & Availability
      05-157 Anti-MAP Kinase 2/Erk2 Antibody, clone 1B3B9 Show Pricing & Availability
      05-957 Anti-MAP Kinase 1/Erk 1 Antibody, CT, rabbit monoclonal Show Pricing & Availability
      06-333 Anti-MAP Kinase 2/Erk2 Antibody Show Pricing & Availability
      16-111 Anti-MAP Kinase 1/2 (Erk1/2) Antibody, agarose Show Pricing & Availability
      16-284 Anti-MAP Kinase 1/2 (Erk1/2) Antibody, CT, Alexa Fluor® 555 conjugate Show Pricing & Availability
      FCABS319PE Milli-Mark Anti-MAP Kinase 1/2 (Erk1/2) Antibody, CT -PE Show Pricing & Availability
      FCMAB100P Milli-Mark Anti-Phospho-Erk1/2 Antibody (Thr202/Tyr204, Thr185/Tyr187)-PE Show Pricing & Availability

      Alternative Format

      Catalogue Number Description  
      16-111 Anti-MAP Kinase 1/2 (Erk1/2) Antibody, agarose Show Pricing & Availability
      16-284 Anti-MAP Kinase 1/2 (Erk1/2) Antibody, CT, Alexa Fluor® 555 conjugate Show Pricing & Availability

      Included Positive Control

      Catalogue Number Description  
      12-305 3T3/A31 Cell Lysate Show Pricing & Availability

      Product Families

      Categories

      Life Science Research > Antibodies and Assays > Primary Antibodies