05-957 | Anti-MAP Kinase 1/Erk 1 Antibody, CT, rabbit monoclonal

05-957
100 µL  
Retrieving price...
Price could not be retrieved
Minimum Quantity needs to be mulitiple of
Upon Order Completion More Information
You Saved ()
 
Request Pricing
Limited AvailabilityLimited Availability
In Stock 
Discontinued
Limited Quantities Available
Availability to be confirmed
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service

      Special Offers

       

      Contact Customer Service

      Click To Print This Page

      Overview

      Replacement Information

      Key Spec Table

      Species ReactivityKey ApplicationsHostFormatAntibody Type
      M, RIP, WBRbPurifiedMonoclonal Antibody
      Description
      Catalogue Number05-957
      Brand Family Upstate
      Trade Name
      • Upstate
      DescriptionAnti-MAP Kinase 1/Erk 1 Antibody, CT, rabbit monoclonal
      References
      Product Information
      FormatPurified
      Applications
      ApplicationDetect MAP Kinase 1/Erk 1 using this Anti-MAP Kinase 1/Erk 1 Antibody, CT validated for use in IP & WB.
      Key Applications
      • Immunoprecipitation
      • Western Blotting
      Biological Information
      Immunogensynthetic peptide corresponding to rat Erk1, amino acids 346-380 (CGGPFTFDMELDDLPKERLKELIFQETARFQPGAPEAP)
      HostRabbit
      SpecificityMAP Kinase 1/Erk1
      IsotypeIgG
      Species Reactivity
      • Mouse
      • Rat
      Antibody TypeMonoclonal Antibody
      Entrez Gene Number
      Entrez Gene SummaryThe protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene.
      Gene Symbol
      • MAPK1
      • p38
      • ERK
      • P42MAPK
      • ERK2
      • p40
      • PRKM1
      • p41mapk
      • PRKM2
      • MAPK2
      • p42-MAPK
      • p41
      • ERK-2
      • ERT1
      Purification MethodProtein A Purfied
      UniProt Number
      UniProt SummaryFUNCTION: SwissProt: P28482 # Involved in both the initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors such as ELK1. Phosphorylates EIF4EBP1; required for initiation of translation. Phosphorylates microtubule-associated protein 2 (MAP2). Phosphorylates SPZ1 (By similarity). Phosphorylates heat shock factor protein 4 (HSF4).
      COFACTOR: Magnesium (By similarity).
      SIZE: 360 amino acids; 41390 Da
      SUBUNIT: Interacts with MORG1 (By similarity). Binds to HIV-1 Nef through its SH3 domain. This interaction inhibits its tyrosine- kinase activity. Interacts with HSF4.
      DOMAIN: SwissProt: P28482 The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.
      PTM: Dually phosphorylated on Thr-185 and Tyr-187, which activates the enzyme.
      SIMILARITY: Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily. & Contains 1 protein kinase domain.
      Molecular Weight44 kDa
      Physicochemical Information
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Quality AssuranceRoutinely evaluated by immunoblot in RIPA lysates of 3T3/NIH cells
      Usage Statement
      • Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
      Storage and Shipping Information
      Storage Conditions2 years at -20°C from date of shipment
      Packaging Information
      Material Size100 µL
      Transport Information
      Supplemental Information
      Specifications

      Documentation

      SDS

      Title

      Safety Data Sheet (SDS) 

      Certificates of Analysis

      TitleLot Number
      Anti-MAP Kinase 1/Erk 1, CT - 30627 30627

      References

      Reference overviewPub Med ID
      Fibroblast growth factor 22 is not essential for skin development and repair but plays a role in tumorigenesis.
      Jarosz, M; Robbez-Masson, L; Chioni, AM; Cross, B; Rosewell, I; Grose, R
      PloS one  7  e39436  2012

      Show Abstract
      22737238 22737238
      Isoelectric focusing technology quantifies protein signaling in 25 cells.
      O'Neill, RA; Bhamidipati, A; Bi, X; Deb-Basu, D; Cahill, L; Ferrante, J; Gentalen, E; Glazer, M; Gossett, J; Hacker, K; Kirby, C; Knittle, J; Loder, R; Mastroieni, C; Maclaren, M; Mills, T; Nguyen, U; Parker, N; Rice, A; Roach, D; Suich, D; Voehringer, D; Voss, K; Yang, J; Yang, T; Vander Horn, PB
      Proceedings of the National Academy of Sciences of the United States of America  103  16153-8  2006

      Show Abstract
      17053065 17053065
      The Ras-MAPK signal transduction pathway, cancer and chromatin remodeling.
      Dunn, Katherine L, et al.
      Biochem. Cell Biol., 83: 1-14 (2005)  2005

      Show Abstract
      15746962 15746962
      Wiring diagrams of MAPK regulation by MEKK1, 2, and 3.
      Uhlik, Mark T, et al.
      Biochem. Cell Biol., 82: 658-63 (2004)  2004

      Show Abstract
      15674433 15674433
      ERK and p38 MAPK-activated protein kinases: a family of protein kinases with diverse biological functions.
      Roux, Philippe P and Blenis, John
      Microbiol. Mol. Biol. Rev., 68: 320-44 (2004)  2004

      Show Abstract
      15187187 15187187
      Regulatory mechanisms and function of ERK MAP kinases.
      Torii, Satoru, et al.
      J. Biochem., 136: 557-61 (2004)  2004

      Show Abstract
      15632293 15632293

      Related Products & Applications

      Related Products

      Catalogue Number Description  
      04-349 Anti-MAP Kinase 2/Erk2 Antibody, clone E460, rabbit monoclonal Show Pricing & Availability
      04-797 Anti-phospho-MAP Kinase 1/2 (Erk1/2)(Thr185/Tyr187) Antibody, clone AW39 Show Pricing & Availability
      05-157 Anti-MAP Kinase 2/Erk2 Antibody, clone 1B3B9 Show Pricing & Availability
      06-182 Anti-MAP Kinase 1/2 (Erk1/2) Antibody, CT Show Pricing & Availability
      06-333 Anti-MAP Kinase 2/Erk2 Antibody Show Pricing & Availability
      16-111 Anti-MAP Kinase 1/2 (Erk1/2) Antibody, agarose Show Pricing & Availability
      16-284 Anti-MAP Kinase 1/2 (Erk1/2) Antibody, CT, Alexa Fluor® 555 conjugate Show Pricing & Availability
      FCABS319PE Milli-Mark Anti-MAP Kinase 1/2 (Erk1/2) Antibody, CT -PE Show Pricing & Availability
      FCMAB100P Milli-Mark Anti-Phospho-Erk1/2 Antibody (Thr202/Tyr204, Thr185/Tyr187)-PE Show Pricing & Availability

      Product Families

      Categories

      Life Science Research > Antibodies and Assays > Primary Antibodies