196350 | Bak BH3 Fusion Peptide, Cell-Permeable

196350
  
Retrieving price...
Price could not be retrieved
Upon Order Completion More Information
You Saved ()
 
Request Pricing
Limited Availability Limited Availability
Discontinued
There is a newer version of this product
Limited Quantities Available
Availability to be confirmed
      Will advise

       

      Contact Customer Service

         CompareClick To Print This Page

      Overview

      Key Spec Table

      Empirical Formula
      C₁₉₆H₃₂₁N₆₅O₄₇S₂
      Description
      Overview

      This product has been discontinued.





      A cell-permeable Antennapedia-BH3 (Bcl-2 homology 3 domain from Bak) fusion peptide that binds to Bcl-xL and antagonizes its anti-apoptotic function. Reported to induce apoptosis in HeLa cells (~50 µM). Cell death is reported to occur via a cytochrome c-independent activation of caspases.
      Catalogue Number 196350
      Brand Family Calbiochem®
      Synonyms RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY, Ant-BH3
      References
      References Holinger, E.P., et al. 1999. J. Biol. Chem. 274, 13298.
      Cosulich, S.C., et al. 1997. Curr. Biol. 7, 913.
      Product Information
      ATP Competitive N
      Form Off-white lyophilized solid
      Formulation Supplied as a trifluoroacetate salt.
      Hill Formula C₁₉₆H₃₂₁N₆₅O₄₇S₂
      Chemical formula C₁₉₆H₃₂₁N₆₅O₄₇S₂
      Molar Mass 4404.2
      Hygroscopic Hygroscopic
      Peptide Sequence H-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Met-Gly-Gln-Val-Gly-Arg-Gln-Leu-Ala-Ile-Ile-Gly-Asp-Asp-Ile-Asn-Arg-Arg-Tyr-OH
      Reversible N
      Applications
      Biological Information
      Primary Target Bcl-xL
      Purity ≥95% by HPLC
      Physicochemical Information
      Cell permeable Y
      Solubility DMSO
      Peptide Sequence H-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Met-Gly-Gln-Val-Gly-Arg-Gln-Leu-Ala-Ile-Ile-Gly-Asp-Asp-Ile-Asn-Arg-Arg-Tyr-OH
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Ambient Temperature Only
      Toxicity Standard Handling
      Storage -20°C
      Hygroscopic Hygroscopic
      Do not freeze No
      Special Instructions Following reconstitution, aliquot and freeze at -20°C. Stock solutions are stable for up to 1 month at -20°C.
      Packaging Information
      Packaged under inert gas Packaged under inert gas
      Transport Information
      Supplemental Information
      Specifications

      Documentation

      MSDS

      Languages
      Danmark Deutschland Ellas
      English España France
      Italia Korea Magyarország
      Nederland  Norge Polska
      Portugal Suomi Sverige
      България

      Certificates of Analysis

      TitleLot Number
      196350
      Data Sheet

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision 17-April-2008 RFH
      Synonyms RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY, Ant-BH3
      Description A cell-permeable peptide consisting of the Bcl-2 homology 3 (BH3) domain from Bak and the internalization sequence from the Antennapedia (Ant). Selectively binds to Bcl-xL and antagonizes its anti-apoptotic function. Reported to induce apoptosis (~50 µM) in HeLa cells. May function through the formation of inactive dimers with death suppressors. Induction of apoptosis with Ant-BH3 is reported to occur in about 2-3 h via cytochrome c-independent induction of caspases.
      Form Off-white lyophilized solid
      Formulation Supplied as a trifluoroacetate salt.
      Intert gas (Yes/No) Packaged under inert gas
      Molar mass 4404.2
      Chemical formula C₁₉₆H₃₂₁N₆₅O₄₇S₂
      Peptide Sequence H-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Met-Gly-Gln-Val-Gly-Arg-Gln-Leu-Ala-Ile-Ile-Gly-Asp-Asp-Ile-Asn-Arg-Arg-Tyr-OH
      Purity ≥95% by HPLC
      Solubility DMSO (10 mg/ml)
      Storage -20°C
      Hygroscopic
      No
      Special Instructions Following reconstitution, aliquot and freeze at -20°C. Stock solutions are stable for up to 1 month at -20°C.
      Toxicity Standard Handling
      References Holinger, E.P., et al. 1999. J. Biol. Chem. 274, 13298.
      Cosulich, S.C., et al. 1997. Curr. Biol. 7, 913.