196350 | Bak BH3 Fusion Peptide, Cell-Permeable

196350
  
Recuperando precio...
No pudo obtenerse el precio
Al finalizar el pedido Más información
Ahorró ()
 
Solicitar precio
Disponibilidad a confirmar Disponibilidad a confirmar
Suspendido
Cantidades limitadas disponibles
Debe confirmarse disponibilidad
      Se avisará

       

      Póngase en contacto con el Servicio de Atención al Cliente

         CompararClick To Print This Page

      Overview

      Tabla espec. clave

      Fórmula empírica
      C₁₉₆H₃₂₁N₆₅O₄₇S₂
      Descripción
      Visión de conjunto

      This product has been discontinued.





      A cell-permeable Antennapedia-BH3 (Bcl-2 homology 3 domain from Bak) fusion peptide that binds to Bcl-xL and antagonizes its anti-apoptotic function. Reported to induce apoptosis in HeLa cells (~50 µM). Cell death is reported to occur via a cytochrome c-independent activation of caspases.
      Número de catálogo 196350
      Marca de familia Calbiochem®
      Sinónimos RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY, Ant-BH3
      Referencias bibliográficas
      Referencias bibliográficas Holinger, E.P., et al. 1999. J. Biol. Chem. 274, 13298.
      Cosulich, S.C., et al. 1997. Curr. Biol. 7, 913.
      Información del producto
      ATP Competitivo N
      Formulario Off-white lyophilized solid
      Formulación Supplied as a trifluoroacetate salt.
      Fórmula Hill C₁₉₆H₃₂₁N₆₅O₄₇S₂
      Fórmula química C₁₉₆H₃₂₁N₆₅O₄₇S₂
      Molar Mass 4404.2
      Higroscópico Hygroscopic
      Secuencia peptídica H-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Met-Gly-Gln-Val-Gly-Arg-Gln-Leu-Ala-Ile-Ile-Gly-Asp-Asp-Ile-Asn-Arg-Arg-Tyr-OH
      Reversible N
      Aplicaciones
      Información biológica
      Objetivo principal Bcl-xL
      Pureza ≥95% by HPLC
      Información fisicoquímica
      Permeabilidad celular Y
      Solubilidad DMSO
      Secuencia peptídica H-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Met-Gly-Gln-Val-Gly-Arg-Gln-Leu-Ala-Ile-Ile-Gly-Asp-Asp-Ile-Asn-Arg-Arg-Tyr-OH
      Dimensiones
      Información de materiales
      Información toxicológica
      Información de seguridad según el GHS
      Información de seguridad
      Declaraciones de uso del producto
      Información de almacenamiento y transporte
      Código de envío Ambient Temperature Only
      Toxicidad Standard Handling
      Almacenamiento -20°C
      Higroscópico Hygroscopic
      No congelar No
      Instrucciones especiales Following reconstitution, aliquot and freeze at -20°C. Stock solutions are stable for up to 1 month at -20°C.
      Información sobre embalaje
      Envasado en atmósfera inerte Packaged under inert gas
      Información de transporte
      Información complementaria
      Especificaciones

      Documentation

      Ficha datos de seguridad (MSDS)

      Idiomas
      Danmark Deutschland Ellas
      English España France
      Italia Korea Magyarország
      Nederland  Norge Polska
      Portugal Suomi Sverige
      България

      Certificados de análisis

      CargoNúmero de lote
      196350

      Referencias bibliográficas

      Visión general referencias
      Holinger, E.P., et al. 1999. J. Biol. Chem. 274, 13298.
      Cosulich, S.C., et al. 1997. Curr. Biol. 7, 913.
      Ficha técnica

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revisión 17-April-2008 RFH
      Sinónimos RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY, Ant-BH3
      Descripción A cell-permeable peptide consisting of the Bcl-2 homology 3 (BH3) domain from Bak and the internalization sequence from the Antennapedia (Ant). Selectively binds to Bcl-xL and antagonizes its anti-apoptotic function. Reported to induce apoptosis (~50 µM) in HeLa cells. May function through the formation of inactive dimers with death suppressors. Induction of apoptosis with Ant-BH3 is reported to occur in about 2-3 h via cytochrome c-independent induction of caspases.
      Formulario Off-white lyophilized solid
      Formulación Supplied as a trifluoroacetate salt.
      Gas inerte (Sí/No) Packaged under inert gas
      Masa molar 4404.2
      Fórmula química C₁₉₆H₃₂₁N₆₅O₄₇S₂
      Secuencia peptídica H-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Met-Gly-Gln-Val-Gly-Arg-Gln-Leu-Ala-Ile-Ile-Gly-Asp-Asp-Ile-Asn-Arg-Arg-Tyr-OH
      Pureza ≥95% by HPLC
      Solubilidad DMSO (10 mg/ml)
      Almacenamiento -20°C
      Hygroscopic
      Do Not Freeze No
      Special Instructions Following reconstitution, aliquot and freeze at -20°C. Stock solutions are stable for up to 1 month at -20°C.
      Toxicidad Standard Handling
      Referencias bibliográficas Holinger, E.P., et al. 1999. J. Biol. Chem. 274, 13298.
      Cosulich, S.C., et al. 1997. Curr. Biol. 7, 913.