05-23-2005 Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem

05-23-2005
Non è stato possibile trovare il prezzo
La quantità minima deve essere un multiplo di
Al termine dell'ordine Maggiori informazioni
Lei ha salvato ()
 
Richiedi il prezzo
Disponibilità limitataDisponibilità limitata
A magazzino 
Fuori produzione
Disponibili quantità limitate
La disponibilità deve essere confermata
    Prodotti rimanenti: riceverà un nostro avviso
      Prodotti rimanenti: riceverà un nostro avviso
      Will advise
      Contatti il Servizio Clienti
      Contact Customer Service
      Visualizza prezzi e disponibilità
      Click To Print This Page

      Panoramica

      Replacement Information

      Tabella delle specifiche principali

      Empirical FormulaCAS #
      C₁₈₉H₂₈₅N₅₅O₅₇S 90880-35-6

      Prezzi e disponibilità

      Numero di catalogoDisponibilità Confezionamento Qtà/conf Prezzo Quantità
      05-23-2005-0.5MG
      Verifica della disponibilità in corso...
      Disponibilità limitataDisponibilità limitata
      A magazzino 
      Fuori produzione
      Disponibili quantità limitate
      La disponibilità deve essere confermata
        Prodotti rimanenti: riceverà un nostro avviso
          Prodotti rimanenti: riceverà un nostro avviso
          Will advise
          Contatti il Servizio Clienti
          Contact Customer Service

          Bottiglia di vetro .5 mg
          Ricerca del prezzo in corso...
          Non è stato possibile trovare il prezzo
          La quantità minima deve essere un multiplo di
          Al termine dell'ordine Maggiori informazioni
          Lei ha salvato ()
           
          Richiedi il prezzo
          05-23-2005-1MG
          Verifica della disponibilità in corso...
          Disponibilità limitataDisponibilità limitata
          A magazzino 
          Fuori produzione
          Disponibili quantità limitate
          La disponibilità deve essere confermata
            Prodotti rimanenti: riceverà un nostro avviso
              Prodotti rimanenti: riceverà un nostro avviso
              Will advise
              Contatti il Servizio Clienti
              Contact Customer Service

              Fiala di plastica 1 mg
              Ricerca del prezzo in corso...
              Non è stato possibile trovare il prezzo
              La quantità minima deve essere un multiplo di
              Al termine dell'ordine Maggiori informazioni
              Lei ha salvato ()
               
              Richiedi il prezzo
              Description
              OverviewA potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells.
              Catalogue Number05-23-2005
              Brand Family Calbiochem®
              SynonymsNPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂
              References
              ReferencesXiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
              Wahlestedt, C., et al. 1993. Science 259, 528.
              Leibowitz, S.F. 1992. NeuroReport 3, 1023.
              Product Information
              CAS number90880-35-6
              ATP CompetitiveN
              FormWhite to off-white lyophilized solid
              FormulationSupplied as trifluoroacetate salt. Sold on the basis of peptide content.
              Hill FormulaC₁₈₉H₂₈₅N₅₅O₅₇S
              Chemical formulaC₁₈₉H₂₈₅N₅₅O₅₇S
              ReversibleY
              Sold on the basis of peptide contentY
              Applications
              Biological Information
              Primary TargetA potent vasoconstrictor
              Purity≥97% by HPLC
              Physicochemical Information
              Cell permeableN
              Peptide ContentY
              Peptide SequenceH-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH₂
              Dimensions
              Materials Information
              Toxicological Information
              Safety Information according to GHS
              Safety Information
              R PhraseR: 20/21/22

              Harmful by inhalation, in contact with skin and if swallowed.
              S PhraseS: 36

              Wear suitable protective clothing.
              Product Usage Statements
              Storage and Shipping Information
              Ship Code Ambient Temperature Only
              Toxicity Harmful
              Storage -20°C
              Protect from Moisture Protect from moisture
              Do not freeze Ok to freeze
              Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
              Packaging Information
              Transport Information
              Supplemental Information
              Specifications

              Documentation

              MSDS

              Titolo

              Scheda di sicurezza (MSDS) 

              Certificati d'Analisi

              TitoloNumero di lotto
              05-23-2005

              Riferimenti bibliografici

              Panoramica delle referenze
              Xiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
              Wahlestedt, C., et al. 1993. Science 259, 528.
              Leibowitz, S.F. 1992. NeuroReport 3, 1023.
              Scheda tecnica

              Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

              Revision18-September-2008 RFH
              SynonymsNPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂
              DescriptionA potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells.
              FormWhite to off-white lyophilized solid
              FormulationSupplied as trifluoroacetate salt. Sold on the basis of peptide content.
              CAS number90880-35-6
              Chemical formulaC₁₈₉H₂₈₅N₅₅O₅₇S
              Peptide SequenceH-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH₂
              Purity≥97% by HPLC
              Solubility5% Acetic acid (1 mg/ml)
              Storage -20°C
              Protect from moisture
              Do Not Freeze Ok to freeze
              Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
              Toxicity Harmful
              Merck USA index14, 6485
              ReferencesXiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
              Wahlestedt, C., et al. 1993. Science 259, 528.
              Leibowitz, S.F. 1992. NeuroReport 3, 1023.