05-23-2151 | PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem

No pudo obtenerse el precio
La cantidad mínima tiene que ser múltiplo de
Al finalizar el pedido Más información
Ahorró ()
Solicitar precio
Disponibilidad a confirmarDisponibilidad a confirmar
En existencia 
Cantidades limitadas disponibles
Debe confirmarse disponibilidad
    El resto: se avisará
      El resto: se avisará
      Se avisará
      Póngase en contacto con el Servicio de Atención al Cliente
      Ver precios y disponibilidad
      Click To Print This Page


      Replacement Information

      Tabla espec. clave

      Empirical FormulaCAS #
      C₁₄₂H₂₂₄N₄₀O₃₉S 127317-03-7

      Precios y disponibilidad

      Número de referenciaDisponiblidad Embalaje Cant./Env. Precio Cantidad
      Comprobando disponibilidad...
      Disponibilidad a confirmarDisponibilidad a confirmar
      En existencia 
      Cantidades limitadas disponibles
      Debe confirmarse disponibilidad
        El resto: se avisará
          El resto: se avisará
          Se avisará
          Póngase en contacto con el Servicio de Atención al Cliente

          Frasco de vidrio .5 mg
          Recuperando precio...
          No pudo obtenerse el precio
          La cantidad mínima tiene que ser múltiplo de
          Al finalizar el pedido Más información
          Ahorró ()
          Solicitar precio
          OverviewIncreases cAMP levels in a dose-dependent manner (EC50 = 4.7 nM). Increases tyrosine hydroxylase expression in chromaffin cells.
          Catalogue Number05-23-2151
          Brand Family Calbiochem®
          SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂
          ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
          Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027.
          Product Information
          CAS number127317-03-7
          ATP CompetitiveN
          FormWhite to off-white solid
          FormulationSupplied as a trifluoroacetate salt.
          Hill FormulaC₁₄₂H₂₂₄N₄₀O₃₉S
          Chemical formulaC₁₄₂H₂₂₄N₄₀O₃₉S
          Hygroscopic Hygroscopic
          Sold on the basis of peptide contentY
          Biological Information
          Primary TargetIncreases cAMP levels
          Primary Target IC<sub>50</sub>EC50 = 4.7 nM increasing cAMP levels in a dose-dependent manner
          Purity≥98% by HPLC
          Physicochemical Information
          Cell permeableN
          Peptide ContentY
          Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH₂
          Materials Information
          Toxicological Information
          Safety Information according to GHS
          Safety Information
          Product Usage Statements
          Storage and Shipping Information
          Ship Code Ambient Temperature Only
          Toxicity Standard Handling
          Storage -20°C
          Hygroscopic Hygroscopic
          Do not freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 6 months at -20°C.
          Packaging Information
          Transport Information
          Supplemental Information


          Ficha datos de seguridad (MSDS)


          Ficha técnica de seguridad del material (MSDS) 

          Certificados de análisis

          CargoNúmero de lote

          Referencias bibliográficas

          Visión general referencias
          Kobayashi, H., et al. 1994. Brain Res. 647, 145.
          Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027.
          Ficha técnica

          Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

          Revision12-May-2008 JSW
          SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂
          DescriptionIncreases cAMP levels in a dose-dependent manner (EC50 = 4.7 nM). Increases tyrosine hydroxylase expression in chromaffin cells.
          FormWhite to off-white solid
          FormulationSupplied as a trifluoroacetate salt.
          CAS number127317-03-7
          Chemical formulaC₁₄₂H₂₂₄N₄₀O₃₉S
          Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH₂
          Purity≥98% by HPLC
          Solubility5% Acetic acid (1 mg/ml)
          Storage -20°C
          Do Not Freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 6 months at -20°C.
          Toxicity Standard Handling
          ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
          Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027.