05-23-2150 PACAP 38, Ovine - CAS 137061-48-4 - Calbiochem

No pudo obtenerse el precio
La cantidad mínima tiene que ser múltiplo de
Al finalizar el pedido Más información
Ahorró ()
Solicitar precio
Disponibilidad a confirmarDisponibilidad a confirmar
En existencia 
Cantidades limitadas disponibles
Debe confirmarse disponibilidad
    El resto: se avisará
      El resto: se avisará
      Se avisará
      Póngase en contacto con el Servicio de Atención al Cliente
      Contact Customer Service
      Ver precios y disponibilidad
      Click To Print This Page


      Replacement Information

      Tabla espec. clave

      Empirical FormulaCAS #
      C₂₀₃H₃₃₁N₆₃O₅₃S 137061-48-4

      Precios y disponibilidad

      Número de referenciaDisponiblidad Embalaje Cant./Env. Precio Cantidad
      Comprobando disponibilidad...
      Disponibilidad a confirmarDisponibilidad a confirmar
      En existencia 
      Cantidades limitadas disponibles
      Debe confirmarse disponibilidad
        El resto: se avisará
          El resto: se avisará
          Se avisará
          Póngase en contacto con el Servicio de Atención al Cliente
          Contact Customer Service

          Ampolla de plást. .1 mg
          Recuperando precio...
          No pudo obtenerse el precio
          La cantidad mínima tiene que ser múltiplo de
          Al finalizar el pedido Más información
          Ahorró ()
          Solicitar precio
          Comprobando disponibilidad...
          Disponibilidad a confirmarDisponibilidad a confirmar
          En existencia 
          Cantidades limitadas disponibles
          Debe confirmarse disponibilidad
            El resto: se avisará
              El resto: se avisará
              Se avisará
              Póngase en contacto con el Servicio de Atención al Cliente
              Contact Customer Service

              Ampolla de plást. 1 mg
              Recuperando precio...
              No pudo obtenerse el precio
              La cantidad mínima tiene que ser múltiplo de
              Al finalizar el pedido Más información
              Ahorró ()
              Solicitar precio
              OverviewMore active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50 = 7 nM).
              Catalogue Number05-23-2150
              Brand Family Calbiochem®
              SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
              ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
              Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
              Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
              Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.
              Product Information
              CAS number137061-48-4
              ATP CompetitiveN
              FormWhite to off-white solid
              Hill FormulaC₂₀₃H₃₃₁N₆₃O₅₃S
              Chemical formulaC₂₀₃H₃₃₁N₆₃O₅₃S
              Hygroscopic Hygroscopic
              Sold on the basis of peptide contentY
              Biological Information
              Primary TargetAdenylate cyclase
              Primary Target IC<sub>50</sub>EC50 = 7 nM against adenylate cyclase
              Purity≥96% by HPLC
              Physicochemical Information
              Cell permeableN
              Peptide ContentY
              Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂
              Materials Information
              Toxicological Information
              Safety Information according to GHS
              Safety Information
              Product Usage Statements
              Storage and Shipping Information
              Ship Code Ambient Temperature Only
              Toxicity Standard Handling
              Storage -20°C
              Hygroscopic Hygroscopic
              Do not freeze Ok to freeze
              Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
              Packaging Information
              Transport Information
              Supplemental Information


              Ficha datos de seguridad (MSDS)


              Ficha técnica de seguridad del material (MSDS) 

              Certificados de análisis

              CargoNúmero de lote

              Referencias bibliográficas

              Visión general referencias
              Kobayashi, H., et al. 1994. Brain Res. 647, 145.
              Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
              Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
              Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.
              Ficha técnica

              Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

              Revision12-May-2008 JSW
              SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
              DescriptionMore active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50 = 7 nM).
              FormWhite to off-white solid
              CAS number137061-48-4
              Chemical formulaC₂₀₃H₃₃₁N₆₃O₅₃S
              Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂
              Purity≥96% by HPLC
              Solubility5% Acetic Acid (1 mg/ml)
              Storage -20°C
              Do Not Freeze Ok to freeze
              Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
              Toxicity Standard Handling
              ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
              Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
              Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
              Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.