05-23-2150 PACAP 38, Ovine - CAS 137061-48-4 - Calbiochem

More active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC₅₀ = 7 nM).

MSDS (material safety data sheet) or SDS, CoA and CoQ, dossiers, brochures and other available documents.

Synonyms: Pituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂

Primary Target: Adenylate cyclase
05-23-2150
Price could not be retrieved
Minimum Quantity needs to be mulitiple of
Upon Order Completion More Information
You Saved ()
 
—
Request Pricing
—
Limited AvailabilityLimited Availability
In Stock 
Discontinued
Limited Quantities Available
Availability to be confirmed
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service
      Contact Customer Service
      View Pricing & Availability
      Click To Print This Page

      Overview

      Replacement Information

      Key Spec Table

      Empirical FormulaCAS #
      C₂₀₃H₃₃₁N₆₃O₅₃S137061-48-4

      Pricing & Availability

      Catalogue NumberAvailability Packaging Qty/Pack Price Quantity
      05-23-2150-0.1MG
      Retrieving availability...
      —
      Limited AvailabilityLimited Availability
      In Stock 
      Discontinued
      Limited Quantities Available
      Availability to be confirmed
        Remaining : Will advise
          Remaining : Will advise
          Will advise
          Contact Customer Service
          Contact Customer Service

          		 Plastic ampoule .1 mg
          Retrieving price...
          Price could not be retrieved
          Minimum Quantity needs to be mulitiple of
          Upon Order Completion More Information
          You Saved ()
           
          —
          Request Pricing
          		 —
          05-23-2150-1MG
          Retrieving availability...
          —
          Limited AvailabilityLimited Availability
          In Stock 
          Discontinued
          Limited Quantities Available
          Availability to be confirmed
            Remaining : Will advise
              Remaining : Will advise
              Will advise
              Contact Customer Service
              Contact Customer Service

              		 Plastic ampoule 1 mg
              Retrieving price...
              Price could not be retrieved
              Minimum Quantity needs to be mulitiple of
              Upon Order Completion More Information
              You Saved ()
               
              —
              Request Pricing
              		 —
              Description
              OverviewMore active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50 = 7 nM).
              Catalogue Number05-23-2150
              Brand Family Calbiochem®
              SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
              References
              ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
              Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
              Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
              Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.
              Product Information
              CAS number137061-48-4
              ATP CompetitiveN
              FormWhite to off-white solid
              Hill FormulaC₂₀₃H₃₃₁N₆₃O₅₃S
              Chemical formulaC₂₀₃H₃₃₁N₆₃O₅₃S
              Hygroscopic Hygroscopic
              ReversibleN
              Sold on the basis of peptide contentY
              Applications
              Biological Information
              Primary TargetAdenylate cyclase
              Primary Target IC<sub>50</sub>EC50 = 7 nM against adenylate cyclase
              Purity≥96% by HPLC
              Physicochemical Information
              Cell permeableN
              Peptide ContentY
              Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂
              Dimensions
              Materials Information
              Toxicological Information
              Safety Information according to GHS
              Safety Information
              Product Usage Statements
              Storage and Shipping Information
              Ship Code Ambient Temperature Only
              Toxicity Standard Handling
              Storage -20°C
              Hygroscopic Hygroscopic
              Do not freeze Ok to freeze
              Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
              Packaging Information
              Transport Information
              Supplemental Information
              Specifications

              Documentation

              SDS

              Title

              Safety Data Sheet (SDS) 

              Certificates of Analysis

              TitleLot Number
              05-23-2150

              References

              Reference overview
              Kobayashi, H., et al. 1994. Brain Res. 647, 145.
              Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
              Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
              Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.
              Data Sheet

              Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

              Revision12-May-2008 JSW
              SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
              DescriptionMore active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50 = 7 nM).
              FormWhite to off-white solid
              CAS number137061-48-4
              Chemical formulaC₂₀₃H₃₃₁N₆₃O₅₃S
              Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂
              Purity≥96% by HPLC
              Solubility5% Acetic Acid (1 mg/ml)
              Storage -20°C
              Hygroscopic
              Do Not Freeze Ok to freeze
              Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
              Toxicity Standard Handling
              ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
              Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
              Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
              Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.