Information
X


196350  Bak BH3 Fusion Peptide, Cell-Permeable

RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY, Ant-BH3

For general questions please contact our Customer Service:

Merck KGaA
Frankfurter Str. 250
64293 Darmstadt
Germany
Phone: +49 6151 72-0
Fax: +49 6151 72 2000

Contact us


19 June 2013

Register to get full access!

 

MSDS
Danmark Deutschland Ellas
English España France
Italia Korea Magyarország
Nederland  Norge Polska
Portugal Suomi Sverige
България   

© Merck KGaA, Darmstadt, Germany, 2013


x

Welcome to Merck Millipore

 

Europe, Middle East and Africa Asia / Pacific North America, Central America and the Caribbean South America

Please choose your country:

North America, Central America and the Caribbean

South America

Europe, Middle East and Africa

Asia / Pacific

All countries from A to Z

If you can't find your country please click here.

 

Privacy Statement

 

x

Merck Chemicals Cart ()

You are entering the Millipore online shop. Both carts are maintained for you while you shop between sites. We recommend to complete your Merck order before visiting Millipore.com.

Go to Millipore Proceed to checkout


What kind of products are you looking for?

Millipore

Bio manufacturing and Life science.

Merck Chemicals

High-quality industrial and laboratory chemicals.


Important message


It is currently not possible to order Bioscience products together with other Merck products. We recommend completing your current order first.

Do you wish to proceed without completing your current order? If so, this will empty your shopping cart.