Millipore Sigma Vibrant Logo
Attention: We have moved. Merck Millipore products are no longer available for purchase on MerckMillipore.com.Learn More

198800 BeKm-1, Mesobuthus eupeus, Recombinant, E. coli

MSDS (material safety data sheet) or SDS, CoA and CoQ, dossiers, brochures and other available documents.

Synonyms: Peptide Inhibitor of M-type K+ Current, RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF

Primary Target: ERG1 K+ channels
198800
  
Purchase on Sigma-Aldrich

Overview

Replacement Information

Key Spec Table

Empirical Formula
C₁₇₄H₂₆₆N₅₁O₅₁S₆
Description
Overview

This product has been discontinued.





Recombinant, Mesobuthus eupeus BeKm-1 expressed in E. coli. Specifically blocks ERG1 K+ channels (IC50 = 3.3 nM).
Catalogue Number198800
Brand Family Calbiochem®
SynonymsPeptide Inhibitor of M-type K+ Current, RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF
References
ReferencesKorolkova, Y.V., et al. 2001. J. Biol. Chem. 276, 9868.
Filippov, A.K., et al. 1996. FEBS Lett. 384, 277.
Product Information
ATP CompetitiveN
FormLyophilized
Hill FormulaC₁₇₄H₂₆₆N₅₁O₅₁S₆
Chemical formulaC₁₇₄H₂₆₆N₅₁O₅₁S₆
Hygroscopic Hygroscopic
ReversibleN
Applications
Biological Information
Primary TargetERG1 K+ channels
Primary Target IC<sub>50</sub>3.3 nM against ERG1 K+ channels
Purity≥98% by HPLC
Physicochemical Information
Cell permeableN
Peptide SequenceH-Arg-Pro-Thr-Asp-Ile-Lys-Cys⁷-Ser-Glu-Ser-Tyr-Gln-Cys¹³-Phe-Pro-Val-Cys¹⁷-Lys-Ser-Arg-Phe-Gly-Lys-Thr-Asn-Gly-Arg-Cys²⁸-Val-Asn-Gly-Phe-Cys³³-Asp-Cys³⁵-Phe-OH Disulfide bonds: Cys⁷ → Cys²⁸; Cys¹³ → Cys³³; Cys¹⁷ → Cys³⁵
Dimensions
Materials Information
Toxicological Information
Safety Information according to GHS
Safety Information
R PhraseR: 20/21/22

Harmful by inhalation, in contact with skin and if swallowed.
S PhraseS: 36

Wear suitable protective clothing.
Product Usage Statements
Storage and Shipping Information
Ship Code Ambient Temperature Only
Toxicity Harmful
Storage -20°C
Hygroscopic Hygroscopic
Do not freeze Ok to freeze
Special InstructionsFollowing reconstitution aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
Packaging Information
Transport Information
Supplemental Information
Specifications
Global Trade Item Number
Catalogue Number GTIN
198800 0

Documentation

BeKm-1, Mesobuthus eupeus, Recombinant, E. coli Certificates of Analysis

TitleLot Number
198800

References

Reference overview
Korolkova, Y.V., et al. 2001. J. Biol. Chem. 276, 9868.
Filippov, A.K., et al. 1996. FEBS Lett. 384, 277.
Data Sheet

Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

Revision28-April-2008 RFH
SynonymsPeptide Inhibitor of M-type K+ Current, RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF
DescriptionRecombinant, Mesobuthus eupeus BeKm-1 expressed in E. coli. Specifically blocks ERG1 K+ channels (IC50 = 3.3 nM). Reported to exhibit properties similar to that of the native toxin.
FormLyophilized
Chemical formulaC₁₇₄H₂₆₆N₅₁O₅₁S₆
Peptide SequenceH-Arg-Pro-Thr-Asp-Ile-Lys-Cys⁷-Ser-Glu-Ser-Tyr-Gln-Cys¹³-Phe-Pro-Val-Cys¹⁷-Lys-Ser-Arg-Phe-Gly-Lys-Thr-Asn-Gly-Arg-Cys²⁸-Val-Asn-Gly-Phe-Cys³³-Asp-Cys³⁵-Phe-OH Disulfide bonds: Cys⁷ → Cys²⁸; Cys¹³ → Cys³³; Cys¹⁷ → Cys³⁵
Purity≥98% by HPLC
SolubilityAqueous buffers (4.3 µg/ml)
Storage -20°C
Hygroscopic
Do Not Freeze Ok to freeze
Special InstructionsFollowing reconstitution aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
Toxicity Harmful
ReferencesKorolkova, Y.V., et al. 2001. J. Biol. Chem. 276, 9868.
Filippov, A.K., et al. 1996. FEBS Lett. 384, 277.