Millipore Sigma Vibrant Logo

05-23-2350 Galanin, Porcine

Galanin, Porcine MSDS (material safety data sheet) or SDS, CoA and CoQ, dossiers, brochures and other available documents.

Synonyms: GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH₂

05-23-2350
  
Retrieving price...
Price could not be retrieved
Minimum Quantity is a multiple of
Maximum Quantity is
Upon Order Completion More Information
You Saved ()
 
—
Request Pricing
—
Limited AvailabilityLimited Availability
In Stock 
Discontinued
Limited Quantities Available
Availability to be confirmed
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service
      Contact Customer Service

       

      Contact Customer Service

      Overview

      Replacement Information

      Key Spec Table

      Empirical FormulaCAS #
      C₁₄₆H₂₁₃N₄₃O₄₀88813-36-9
      Description
      OverviewA biologically active neuropeptide that has been shown to inhibit secretion of somatostatin, insulin, and pancreatic polypeptide. Also induces repolarization and reduces free Ca2+ due to interference with voltage-activated Ca2+ channels. Inhibits ω-conotoxin GVIA-sensitive Ca2+ channels in parasympathetic neurons. Reported to have an inhibitory role in transmission of nociceptive information.
      Catalogue Number05-23-2350
      Brand Family Calbiochem®
      SynonymsGWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH₂
      References
      ReferencesYu, L., et al. 2001. Regul. Pept. 101, 179. Merriam, L.A., and Parsons, R.L. 1995. J. Neurophysiol. 73, 1374. Homaidan, F.R. 1991. Proc. Natl. Acad. Sci. USA 88, 8744. Lindskog, S., and Ahren, B. 1991. Eur. J. Pharmacol. 205, 21. Ahren, B., et al. 1988. FEBS Lett. 229, 233. Tatemoto, K., et al. 1983. FEBS Lett. 164, 124.
      Product Information
      CAS number88813-36-9
      FormWhite to off-white lyophilized solid
      FormulationSold on the basis of peptide content.
      Hill FormulaC₁₄₆H₂₁₃N₄₃O₄₀
      Chemical formulaC₁₄₆H₂₁₃N₄₃O₄₀
      Sold on the basis of peptide contentY
      Applications
      Biological Information
      Purity≥97% by HPLC
      Physicochemical Information
      Peptide ContentY
      Peptide SequenceH-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala-NH₂
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Ambient Temperature Only
      Toxicity Standard Handling
      Storage -20°C to 0°C
      Protect from Moisture Protect from moisture
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Packaging Information
      Transport Information
      Supplemental Information
      Specifications

      Documentation

      Galanin, Porcine Certificates of Analysis

      TitleLot Number
      05-23-2350

      References

      Reference overview
      Yu, L., et al. 2001. Regul. Pept. 101, 179. Merriam, L.A., and Parsons, R.L. 1995. J. Neurophysiol. 73, 1374. Homaidan, F.R. 1991. Proc. Natl. Acad. Sci. USA 88, 8744. Lindskog, S., and Ahren, B. 1991. Eur. J. Pharmacol. 205, 21. Ahren, B., et al. 1988. FEBS Lett. 229, 233. Tatemoto, K., et al. 1983. FEBS Lett. 164, 124.
      Data Sheet

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision17-October-2007 JSW
      SynonymsGWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH₂
      DescriptionA biologically active neuropeptide consisting of 29 amino acids. Shown to inhibit secretion of somatostatin, insulin and pancreatic polypeptide. Also induces repolarization and reduces free Ca2+ due to interference with voltage-activated Ca2+ channels. Inhibits ω-conotoxin GVIA-sensitive Ca2+ channels in parasympathetic neurons. Reported to have an inhibitory role in transmission of nociceptive information.
      FormWhite to off-white lyophilized solid
      FormulationSold on the basis of peptide content.
      CAS number88813-36-9
      Chemical formulaC₁₄₆H₂₁₃N₄₃O₄₀
      Peptide SequenceH-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala-NH₂
      Purity≥97% by HPLC
      Solubility5% Acetic acid (1 mg/ml)
      Storage -20°C to 0°C
      Protect from moisture
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Toxicity Standard Handling
      ReferencesYu, L., et al. 2001. Regul. Pept. 101, 179. Merriam, L.A., and Parsons, R.L. 1995. J. Neurophysiol. 73, 1374. Homaidan, F.R. 1991. Proc. Natl. Acad. Sci. USA 88, 8744. Lindskog, S., and Ahren, B. 1991. Eur. J. Pharmacol. 205, 21. Ahren, B., et al. 1988. FEBS Lett. 229, 233. Tatemoto, K., et al. 1983. FEBS Lett. 164, 124.