Millipore Sigma Vibrant Logo

171596 β-Amyloid Peptide (1-42), Rat

Predominant peptide found in the brain of patients with Alzheimer's Disease and Down's Syndrome. Promotes down-regulation of Bcl-2 and upregulation of Bax expression in neurons.

β-Amyloid Peptide (1-42), Rat : FDS (Fiches de données de sécurité), certificats d’analyse (CoA) et de qualité (CoQ), dossiers, brochures et autres documents disponibles.

Synonymes: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

View Products on Sigmaaldrich.com
171596
Voir les Prix & la Disponibilité

Aperçu

Replacement Information

Prix & Disponibilité

Référence DisponibilitéConditionnement Qté Prix Quantité
171596-250UG
Récupération des données relatives à la disponibilité...
—
Disponibilité limitée Disponibilité limitée
En stock 
Interrompu(e)
Disponible en quantités limitées
Disponibilité à confirmer
    Pour le restant : Nous vous tiendrons informé
      Pour le restant : Nous vous tiendrons informé
      Nous vous tiendrons informé
      Contacter le Service Clients
      Contact Customer Service

      		 Ampoule plast. 250 μg
      Prix en cours de récupération
      Le prix n'a pas pu être récupéré
      La quantité minimale doit être un multiple de
      Maximum Quantity is
      À la validation de la commande Plus d'informations
      Vous avez sauvegardé ()
       
      —
      Demander le prix
      		 —
      Description
      OverviewPredominant peptide found in the brain of patients with Alzheimer’s Disease and Down’s Syndrome. Promotes down-regulation of Bcl-2 and upregulation of Bax expression in neurons.
      Catalogue Number171596
      Brand Family Calbiochem®
      SynonymsDAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
      References
      ReferencesParadis, E., et al. 1996. J. Neurosci. 16, 7533.
      Roher, A.E., et al. 1996. J. Biol. Chem. 271, 20631.
      Soto, C., and Castano, E.M. 1996. Biochem. J. 314, 701.
      Murrell, J., et al. 1991. Science 254, 97.
      Goldgaber, D., et al. 1987. Science 235, 877.
      Kang, J., et al. 1987. Nature 325, 733.
      Product Information
      CAS number107761-42-2
      FormLyophilized
      FormulationSupplied as a trifluoroacetate salt.
      Hill FormulaC₁₉₉H₃₀₇N₅₃O₅₉S
      Chemical formulaC₁₉₉H₃₀₇N₅₃O₅₉S
      Hygroscopic Hygroscopic
      Quality LevelMQ100
      Applications
      Biological Information
      Purity≥80% by HPLC
      Physicochemical Information
      Peptide SequenceH-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Ambient Temperature Only
      Toxicity Standard Handling
      Storage -20°C
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Packaging Information
      Transport Information
      Supplemental Information
      Specifications
      Global Trade Item Number
      Référence GTIN
      171596-250UG 04055977207286

      Documentation

      β-Amyloid Peptide (1-42), Rat FDS

      Titre

      Fiche de données de sécurité des matériaux (FDS) 

      β-Amyloid Peptide (1-42), Rat Certificats d'analyse

      TitreNuméro de lot
      171596

      Références bibliographiques

      Aperçu de la référence bibliographique
      Paradis, E., et al. 1996. J. Neurosci. 16, 7533.
      Roher, A.E., et al. 1996. J. Biol. Chem. 271, 20631.
      Soto, C., and Castano, E.M. 1996. Biochem. J. 314, 701.
      Murrell, J., et al. 1991. Science 254, 97.
      Goldgaber, D., et al. 1987. Science 235, 877.
      Kang, J., et al. 1987. Nature 325, 733.

      Brochure

      Titre
      Alzheimer's Disease Brochure & Technical Guide
      Fiche technique

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision14-April-2008 RFH
      SynonymsDAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
      Descriptionβ-Amyloid Peptide (Aβ) is the main constituent in both senile plaques and diffuse deposits in Alzheimer's diseased brains. Under appropriate conditions, the soluble amyloid peptides aggregate into the fibrils associated with the disease state. It has proposed that Aβ peptide may increase the sensitivity of neurons to oxidative damage by downregulating expression of bcl-2, a key anti-apoptotic protein and upregulating of bax expression, a protein known to induce cell death.
      FormLyophilized
      FormulationSupplied as a trifluoroacetate salt.
      CAS number107761-42-2
      Chemical formulaC₁₉₉H₃₀₇N₅₃O₅₉S
      Peptide SequenceH-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
      Purity≥80% by HPLC
      Solubility5% Acetic Acid (1 mg/ml)
      Storage -20°C
      Hygroscopic
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Toxicity Standard Handling
      ReferencesParadis, E., et al. 1996. J. Neurosci. 16, 7533.
      Roher, A.E., et al. 1996. J. Biol. Chem. 271, 20631.
      Soto, C., and Castano, E.M. 1996. Biochem. J. 314, 701.
      Murrell, J., et al. 1991. Science 254, 97.
      Goldgaber, D., et al. 1987. Science 235, 877.
      Kang, J., et al. 1987. Nature 325, 733.