219482 Sigma-AldrichCaveolin-1 Scaffolding Domain Peptide, Cell-permeable - Calbiochem
Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, blocks eNOS activity and cellular NO release in vitro and reduces inflammation and tumorigenesis in vivo.
More>> Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, blocks eNOS activity and cellular NO release in vitro and reduces inflammation and tumorigenesis in vivo. Less<<Sinonimi: AP-Cav, Pen-C1-SD, RQIKIWFQNRRMKWKK-DGIWKASFTTFTVTKYWFYR, Cavtratin
Prodotti consigliati
Panoramica
| Replacement Information |
|---|
Tabella delle specifiche principali
| Empirical Formula |
|---|
| C₂₂₈H₃₃₅N₆₁O₄₉S |
Prezzi e disponibilità
| Numero di catalogo | Disponibilità | Confezionamento | Qtà/conf | Prezzo | Quantità | |
|---|---|---|---|---|---|---|
| 219482-1MG |
|
Fiala di plastica | 1 mg |
|
— |
| Product Information | |
|---|---|
| ATP Competitive | N |
| Form | White lyophilized solid |
| Formulation | Supplied as a trifluoroacetate salt. |
| Hill Formula | C₂₂₈H₃₃₅N₆₁O₄₉S |
| Chemical formula | C₂₂₈H₃₃₅N₆₁O₄₉S |
| HS Code | 2933 99 99 |
| Hygroscopic | Hygroscopic |
| Reversible | N |
| Quality Level | MQ100 |
| Applications | |
|---|---|
| Application | Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, blocks eNOS activity and cellular NO release in vitro and reduces inflammation and tumorigenesis in vivo. |
| Biological Information | |
|---|---|
| Primary Target | eNOS |
| Purity | ≥95% by HPLC |
| Dimensions |
|---|
| Materials Information |
|---|
| Toxicological Information |
|---|
| Safety Information according to GHS |
|---|
| Safety Information |
|---|
| Product Usage Statements |
|---|
| Packaging Information | |
|---|---|
| Packaged under inert gas | Packaged under inert gas |
| Transport Information |
|---|
| Supplemental Information |
|---|
| Specifications |
|---|
| Global Trade Item Number | |
|---|---|
| Numero di catalogo | GTIN |
| 219482-1MG | 04055977218565 |
Documentation
Caveolin-1 Scaffolding Domain Peptide, Cell-permeable - Calbiochem MSDS
| Titolo |
|---|
Caveolin-1 Scaffolding Domain Peptide, Cell-permeable - Calbiochem Certificati d'Analisi
| Titolo | Numero di lotto |
|---|---|
| 219482 |
Riferimenti bibliografici
| Panoramica delle referenze |
|---|
| Bernatchez, P.N., et al. 2005. Proc. Natl. Acad. Sci. USA 102, 761. Williams, T.M., et al. 2004. J. Biol. Chem. 279, 51630. Gratton, J.P., et al. 2003. Cancer Cell 4, 31. Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716. Liu, J., et al. 2002. J. Biol. Chem. 277, 10661. Bucci, M., et al. 2000. Nat. Med. 6, 1362. Okamoto, T., et al. 1998. J. Biol. Chem. 273, 5419. |



