05-23-2150 Sigma-AldrichPACAP 38, Ovine - CAS 137061-48-4 - Calbiochem
More active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC₅₀ = 7 nM).
More>> More active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC₅₀ = 7 nM). Less<<Sinonimi: Pituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
Prodotti consigliati
Panoramica
| Replacement Information |
|---|
Tabella delle specifiche principali
| CAS # | Empirical Formula |
|---|---|
| 137061-48-4 | C₂₀₃H₃₃₁N₆₃O₅₃S |
Prezzi e disponibilità
| Numero di catalogo | Disponibilità | Confezionamento | Qtà/conf | Prezzo | Quantità | |
|---|---|---|---|---|---|---|
| 05-23-2150-0.1MG |
|
Fiala di plastica | .1 mg |
|
— |
| Product Information | |
|---|---|
| CAS number | 137061-48-4 |
| ATP Competitive | N |
| Form | White to off-white solid |
| Hill Formula | C₂₀₃H₃₃₁N₆₃O₅₃S |
| Chemical formula | C₂₀₃H₃₃₁N₆₃O₅₃S |
| HS Code | 3822 00 90 |
| Hygroscopic | Hygroscopic |
| Reversible | N |
| Sold on the basis of peptide content | Y |
| Quality Level | MQ100 |
| Applications |
|---|
| Biological Information | |
|---|---|
| Primary Target | Adenylate cyclase |
| Primary Target IC<sub>50</sub> | EC50 = 7 nM against adenylate cyclase |
| Purity | ≥96% by HPLC |
| Dimensions |
|---|
| Materials Information |
|---|
| Toxicological Information |
|---|
| Safety Information according to GHS |
|---|
| Safety Information |
|---|
| Product Usage Statements |
|---|
| Packaging Information |
|---|
| Transport Information |
|---|
| Supplemental Information |
|---|
| Specifications |
|---|
| Global Trade Item Number | |
|---|---|
| Numero di catalogo | GTIN |
| 05-23-2150-0.1MG | 04055977226652 |
Documentation
PACAP 38, Ovine - CAS 137061-48-4 - Calbiochem MSDS
| Titolo |
|---|
PACAP 38, Ovine - CAS 137061-48-4 - Calbiochem Certificati d'Analisi
| Titolo | Numero di lotto |
|---|---|
| 05-23-2150 |
Riferimenti bibliografici
| Panoramica delle referenze |
|---|
| Kobayashi, H., et al. 1994. Brain Res. 647, 145. Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239. Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265. Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81. |



