196350 Sigma-AldrichBak BH3 Fusion Peptide, Cell-Permeable
A cell-permeable Antennapedia-BH3 (Bcl-2 homology 3 domain from Bak) fusion peptide that binds to Bcl-xL and antagonizes its anti-apoptotic function.
More>> A cell-permeable Antennapedia-BH3 (Bcl-2 homology 3 domain from Bak) fusion peptide that binds to Bcl-xL and antagonizes its anti-apoptotic function. Less<<Bak BH3 Fusion Peptide, Cell-Permeable MSDS (material safety data sheet) or SDS, CoA and CoQ, dossiers, brochures and other available documents.
Synonyms: RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY, Ant-BH3
Doporučené produkty
Přehled
Replacement Information |
---|
Tabulka spec. kláve
Empirical Formula |
---|
C₁₉₆H₃₂₁N₆₅O₄₇S₂ |
References | |
---|---|
References | Holinger, E.P., et al. 1999. J. Biol. Chem. 274, 13298. Cosulich, S.C., et al. 1997. Curr. Biol. 7, 913. |
Applications |
---|
Biological Information | |
---|---|
Primary Target | Bcl-xL |
Purity | ≥95% by HPLC |
Dimensions |
---|
Materials Information |
---|
Toxicological Information |
---|
Safety Information according to GHS |
---|
Safety Information |
---|
Product Usage Statements |
---|
Packaging Information | |
---|---|
Packaged under inert gas | Packaged under inert gas |
Transport Information |
---|
Supplemental Information |
---|
Specifications |
---|
Documentation
Bak BH3 Fusion Peptide, Cell-Permeable Certificates of Analysis
Title | Lot Number |
---|---|
196350 |
References
Přehled odkazů |
---|
Holinger, E.P., et al. 1999. J. Biol. Chem. 274, 13298. Cosulich, S.C., et al. 1997. Curr. Biol. 7, 913. |
Brochure
Title |
---|
Caspases and other Apoptosis Related Tools Brochure |