198800 Sigma-AldrichBeKm-1, Mesobuthus eupeus, Recombinant, E. coli
More>>
Less<<
Primary Target:
ERG1 K+ channels
MSDS (material safety data sheet) or SDS, CoA and CoQ, dossiers, brochures and other available documents.
Synonyms: Peptide Inhibitor of M-type K+ Current, RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF
Doporučené produkty
Přehled
Replacement Information |
---|
Tabulka spec. kláve
Empirical Formula |
---|
C₁₇₄H₂₆₆N₅₁O₅₁S₆ |
References | |
---|---|
References | Korolkova, Y.V., et al. 2001. J. Biol. Chem. 276, 9868. Filippov, A.K., et al. 1996. FEBS Lett. 384, 277. |
Product Information | |
---|---|
ATP Competitive | N |
Form | Lyophilized |
Hill Formula | C₁₇₄H₂₆₆N₅₁O₅₁S₆ |
Chemical formula | C₁₇₄H₂₆₆N₅₁O₅₁S₆ |
Hygroscopic | Hygroscopic |
Reversible | N |
Applications |
---|
Biological Information | |
---|---|
Primary Target | ERG1 K+ channels |
Primary Target IC<sub>50</sub> | 3.3 nM against ERG1 K+ channels |
Purity | ≥98% by HPLC |
Dimensions |
---|
Materials Information |
---|
Toxicological Information |
---|
Safety Information according to GHS |
---|
Safety Information | |
---|---|
R Phrase | R: 20/21/22 Harmful by inhalation, in contact with skin and if swallowed. |
S Phrase | S: 36 Wear suitable protective clothing. |
Product Usage Statements |
---|
Packaging Information |
---|
Transport Information |
---|
Supplemental Information |
---|
Specifications |
---|
Documentation
BeKm-1, Mesobuthus eupeus, Recombinant, E. coli Certificates of Analysis
Title | Lot Number |
---|---|
198800 |
References
Přehled odkazů |
---|
Korolkova, Y.V., et al. 2001. J. Biol. Chem. 276, 9868. Filippov, A.K., et al. 1996. FEBS Lett. 384, 277. |