05-23-2350 Galanin, Porcine
More>>
Less<<
Galanin, Porcine MSDS (material safety data sheet) or SDS, CoA and CoQ, dossiers, brochures and other available documents.
Synonyms: GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH₂
Doporučené produkty
Přehled
Replacement Information |
---|
Tabulka spec. kláve
Empirical Formula |
---|
C₁₄₆H₂₁₃N₄₃O₄₀ |
Applications |
---|
Biological Information | |
---|---|
Purity | ≥97% by HPLC |
Physicochemical Information | |
---|---|
Peptide Content | Y |
Peptide Sequence | H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala-NH₂ |
Dimensions |
---|
Materials Information |
---|
Toxicological Information |
---|
Safety Information according to GHS |
---|
Safety Information |
---|
Product Usage Statements |
---|
Packaging Information |
---|
Transport Information |
---|
Supplemental Information |
---|
Specifications |
---|
Documentation
Galanin, Porcine Certificates of Analysis
Title | Lot Number |
---|---|
05-23-2350 |
References
Přehled odkazů |
---|
Yu, L., et al. 2001. Regul. Pept. 101, 179. Merriam, L.A., and Parsons, R.L. 1995. J. Neurophysiol. 73, 1374. Homaidan, F.R. 1991. Proc. Natl. Acad. Sci. USA 88, 8744. Lindskog, S., and Ahren, B. 1991. Eur. J. Pharmacol. 205, 21. Ahren, B., et al. 1988. FEBS Lett. 229, 233. Tatemoto, K., et al. 1983. FEBS Lett. 164, 124. |