Saltar al contenido
Merck

HPA043524

Anti-KCTD13 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-FKSG86, Anti-PDIP1, Anti-POLDIP1, Anti-potassium channel tetramerisation domain containing 13

Iniciar sesión para ver los precios por organización y contrato.

Seleccione un Tamaño



About This Item

UNSPSC Code:
12352203
NACRES:
NA.43
Human Protein Atlas Number:

Nombre del producto

Anti-KCTD13 antibody produced in rabbit, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

RGEDEENREHRVRRIHVRRHITHDERPHGQQIVFKD

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

Gene Information

human ... KCTD13(253980)

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-KCTD13 antibody has been used in western blotting.

Biochem/physiol Actions

KCTD13 (potassium channel tetramerization domain containing 13) controls the multiplication of mammalian cell in vitro and in vivo. It may a play a major role in the modulation of cell cycle during neurogenesis. When high levels of p21 are present in the cell, PDIP1 may participate in DNA replication or repair.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

General description

KCTD13 (potassium channel tetramerization domain containing 13) codes for the polymerase delta-interacting protein 1 (PDIP1). It is expressed in the developing brain. Polymerase delta-interacting protein 1 (PDIP1) is a 36 kDa protein. KCTD13 is located on human chromosome 16p11.2.

Immunogen

potassium channel tetramerisation domain containing 13 recombinant protein epitope signature tag (PrEST)

Other Notes

Corresponding Antigen APREST82321

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Clase de almacenamiento

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Kctd13 deletion reduces synaptic transmission via increased RhoA.
Escamilla CO, et al.
Nature, 551(7679), 227-227 (2017)
KCTD13 is a major driver of mirrored neuroanatomical phenotypes of the 16p11. 2 copy number variant.
Golzio C, et al.
Nature, 485(7398), 363-367 (2012)
H He et al.
Proceedings of the National Academy of Sciences of the United States of America, 98(21), 11979-11984 (2001-10-11)
A cDNA encoding a protein of 36 kDa, polymerase delta-interacting protein 1 (PDIP1), that interacts with the small subunit (p50) of DNA polymerase delta (pol delta) was identified in a two-hybrid screen of a HepG2 cDNA library by using p50
Jianbo Cheng et al.
Proceedings of the National Academy of Sciences of the United States of America, 121(12), e2315707121-e2315707121 (2024-03-15)
KCTD10 belongs to the KCTD (potassiumchannel tetramerization domain) family, many members of which are associated with neuropsychiatric disorders. However, the biological function underlying the association with brain disorders remains to be explored. Here, we reveal that Kctd10 is highly expressed

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico