05-23-2005 Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem

05-23-2005
Árak és elérhetőség megtekintése

Áttekintés

Replacement Information

Kulcsspecifikációk táblázata

Empirical FormulaCAS #
C₁₈₉H₂₈₅N₅₅O₅₇S 90880-35-6

Árak és elérhetőség

Katalógusszám ElérhetőségCsomagolás Menny./csomag Ár Mennyiség
05-23-2005-0.5MG
Elérhetőség betöltése...
Korlátozott elérhetőségKorlátozott elérhetőség
Készleten 
Megszűnt
Korlátozott mennyiségben elérhető
Az elérhetőség megerősítésre vár
    Remaining : Will advise
      Remaining : Will advise
      Tanácsadás
      Lépjen kapcsolatba a vevőszolgálattal
      Contact Customer Service

      Üvegpalack .5 mg
      Az ár letöltése folyamatban...
      Az ár nem tölthető be
      Minimum Quantity needs to be mulitiple of
      Megrendelés befejezésekor További információ
      Elmentette a ()-t
       
      Árajánlat kérése
      05-23-2005-1MG
      Elérhetőség betöltése...
      Korlátozott elérhetőségKorlátozott elérhetőség
      Készleten 
      Megszűnt
      Korlátozott mennyiségben elérhető
      Az elérhetőség megerősítésre vár
        Remaining : Will advise
          Remaining : Will advise
          Tanácsadás
          Lépjen kapcsolatba a vevőszolgálattal
          Contact Customer Service

          Muanyagampulla 1 mg
          Az ár letöltése folyamatban...
          Az ár nem tölthető be
          Minimum Quantity needs to be mulitiple of
          Megrendelés befejezésekor További információ
          Elmentette a ()-t
           
          Árajánlat kérése
          Description
          OverviewA potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells.
          Catalogue Number05-23-2005
          Brand Family Calbiochem®
          SynonymsNPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂
          References
          ReferencesXiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
          Wahlestedt, C., et al. 1993. Science 259, 528.
          Leibowitz, S.F. 1992. NeuroReport 3, 1023.
          Product Information
          CAS number90880-35-6
          ATP CompetitiveN
          FormWhite to off-white lyophilized solid
          FormulationSupplied as trifluoroacetate salt. Sold on the basis of peptide content.
          Hill FormulaC₁₈₉H₂₈₅N₅₅O₅₇S
          Chemical formulaC₁₈₉H₂₈₅N₅₅O₅₇S
          ReversibleY
          Sold on the basis of peptide contentY
          Quality LevelMQ100
          Applications
          Biological Information
          Primary TargetA potent vasoconstrictor
          Purity≥97% by HPLC
          Physicochemical Information
          Cell permeableN
          Peptide ContentY
          Peptide SequenceH-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH₂
          Dimensions
          Materials Information
          Toxicological Information
          Safety Information according to GHS
          Safety Information
          R PhraseR: 20/21/22

          Harmful by inhalation, in contact with skin and if swallowed.
          S PhraseS: 36

          Wear suitable protective clothing.
          Product Usage Statements
          Storage and Shipping Information
          Ship Code Ambient Temperature Only
          Toxicity Harmful
          Storage -20°C
          Protect from Moisture Protect from moisture
          Do not freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
          Packaging Information
          Transport Information
          Supplemental Information
          Specifications

          Documentation

          Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem MSDS

          Title

          Safety Data Sheet (SDS) 

          Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem Certificates of Analysis

          TitleLot Number
          05-23-2005

          References

          Hivatkozások áttekintése
          Xiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
          Wahlestedt, C., et al. 1993. Science 259, 528.
          Leibowitz, S.F. 1992. NeuroReport 3, 1023.
          Data Sheet

          Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

          Revision18-September-2008 RFH
          SynonymsNPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂
          DescriptionA potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells.
          FormWhite to off-white lyophilized solid
          FormulationSupplied as trifluoroacetate salt. Sold on the basis of peptide content.
          CAS number90880-35-6
          Chemical formulaC₁₈₉H₂₈₅N₅₅O₅₇S
          Peptide SequenceH-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH₂
          Purity≥97% by HPLC
          Solubility5% Acetic acid (1 mg/ml)
          Storage -20°C
          Protect from moisture
          Do Not Freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
          Toxicity Harmful
          Merck USA index14, 6485
          ReferencesXiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
          Wahlestedt, C., et al. 1993. Science 259, 528.
          Leibowitz, S.F. 1992. NeuroReport 3, 1023.