05-23-2151 PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem

05-23-2151
Árak és elérhetőség megtekintése

Áttekintés

Replacement Information

Kulcsspecifikációk táblázata

Empirical FormulaCAS #
C₁₄₂H₂₂₄N₄₀O₃₉S 127317-03-7

Árak és elérhetőség

Katalógusszám ElérhetőségCsomagolás Menny./csomag Ár Mennyiség
05-23-2151-0.5MG
Elérhetőség betöltése...
Korlátozott elérhetőségKorlátozott elérhetőség
Készleten 
Megszűnt
Korlátozott mennyiségben elérhető
Az elérhetőség megerősítésre vár
    Remaining : Will advise
      Remaining : Will advise
      Tanácsadás
      Lépjen kapcsolatba a vevőszolgálattal
      Contact Customer Service

      Üvegpalack .5 mg
      Az ár letöltése folyamatban...
      Az ár nem tölthető be
      Minimum Quantity needs to be mulitiple of
      Megrendelés befejezésekor További információ
      Elmentette a ()-t
       
      Árajánlat kérése
      Description
      OverviewIncreases cAMP levels in a dose-dependent manner (EC50 = 4.7 nM). Increases tyrosine hydroxylase expression in chromaffin cells.
      Catalogue Number05-23-2151
      Brand Family Calbiochem®
      SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂
      References
      ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
      Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027.
      Product Information
      CAS number127317-03-7
      ATP CompetitiveN
      FormWhite to off-white solid
      FormulationSupplied as a trifluoroacetate salt.
      Hill FormulaC₁₄₂H₂₂₄N₄₀O₃₉S
      Chemical formulaC₁₄₂H₂₂₄N₄₀O₃₉S
      Hygroscopic Hygroscopic
      ReversibleN
      Sold on the basis of peptide contentY
      Quality LevelMQ100
      Applications
      Biological Information
      Primary TargetIncreases cAMP levels
      Primary Target IC<sub>50</sub>EC50 = 4.7 nM increasing cAMP levels in a dose-dependent manner
      Purity≥98% by HPLC
      Physicochemical Information
      Cell permeableN
      Peptide ContentY
      Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH₂
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Ambient Temperature Only
      Toxicity Standard Handling
      Storage -20°C
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 6 months at -20°C.
      Packaging Information
      Transport Information
      Supplemental Information
      Specifications

      Documentation

      PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem MSDS

      Title

      Safety Data Sheet (SDS) 

      PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem Certificates of Analysis

      TitleLot Number
      05-23-2151

      References

      Hivatkozások áttekintése
      Kobayashi, H., et al. 1994. Brain Res. 647, 145.
      Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027.
      Data Sheet

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision12-May-2008 JSW
      SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂
      DescriptionIncreases cAMP levels in a dose-dependent manner (EC50 = 4.7 nM). Increases tyrosine hydroxylase expression in chromaffin cells.
      FormWhite to off-white solid
      FormulationSupplied as a trifluoroacetate salt.
      CAS number127317-03-7
      Chemical formulaC₁₄₂H₂₂₄N₄₀O₃₉S
      Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH₂
      Purity≥98% by HPLC
      Solubility5% Acetic acid (1 mg/ml)
      Storage -20°C
      Hygroscopic
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 6 months at -20°C.
      Toxicity Standard Handling
      ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
      Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027.