Millipore Sigma Vibrant Logo

05-23-0930 β-Endorphin, Human

05-23-0930
  
Retrieving price...
Price could not be retrieved
Minimum Quantity is a multiple of
Maximum Quantity is
Upon Order Completion More Information
You Saved ()
 
Request Pricing
Limited Availability
Limited Availability
In Stock 
Discontinued
Limited Quantities Available
Availability to be confirmed
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service
      Contact Customer Service

       

      Contact Customer Service

      Overview

      Replacement Information

      Key Spec Table

      CAS #Empirical Formula
      61214-51-5C₁₅₈H₂₅₁N₃₉O₄₆S
      Description
      Overview

      This product has been discontinued.

      We apologize for the inconvenience, but we do not currently have an alternative product.





      Neurohormone secreted by the pituitary gland. The most potent of the opioid peptides. More effective than morphine in tests of opioid receptor binding, analgesia, and catatonia. High doses cause rigidity and hypothermia in rats.
      Catalogue Number05-23-0930
      Brand Family Calbiochem®
      Synonymsβ-Lipoprotein 61-91, Human, YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
      References
      ReferencesDalayeun, J.F., et al. 1993. Biomed. Pharmacother. 47, 311.
      Akil, H., et al. 1984. Annu. Rev. Neurosci. 7, 223.
      Product Information
      CAS number61214-51-5
      FormWhite to off-white lyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      Hill FormulaC₁₅₈H₂₅₁N₃₉O₄₆S
      Chemical formulaC₁₅₈H₂₅₁N₃₉O₄₆S
      Hygroscopic Hygroscopic
      Sold on the basis of peptide contentY
      Applications
      Biological Information
      Purity≥95% by HPLC
      Physicochemical Information
      Peptide ContentY
      Peptide SequenceH-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu-OH
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      RTECSJZ1650000
      Safety Information
      R PhraseR: 20/21/22

      Harmful by inhalation, in contact with skin and if swallowed.
      S PhraseS: 36

      Wear suitable protective clothing.
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Ambient Temperature Only
      Toxicity Harmful
      Storage -20°C
      Protect from Moisture Protect from moisture
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Packaging Information
      Transport Information
      Supplemental Information
      Specifications
      Global Trade Identification Number
      Catalogue Number GTIN
      05-23-0930

      Documentation

      β-Endorphin, Human Certificates of Analysis

      TitleLot Number
      05-23-0930

      References

      Reference overview
      Dalayeun, J.F., et al. 1993. Biomed. Pharmacother. 47, 311.
      Akil, H., et al. 1984. Annu. Rev. Neurosci. 7, 223.
      Data Sheet

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision18-September-2008 RFH
      Synonymsβ-Lipoprotein 61-91, Human, YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
      DescriptionNeurohormone secreted by the pituitary gland. The most potent of the opiate peptides. More effective than morphine in tests of opiate receptor binding, analgesia, and catatonia. High doses cause rigidity and hypothermia in rats.
      FormWhite to off-white lyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      CAS number61214-51-5
      RTECSJZ1650000
      Chemical formulaC₁₅₈H₂₅₁N₃₉O₄₆S
      Peptide SequenceH-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu-OH
      Purity≥95% by HPLC
      Solubility5% Acetic acid (1 mg/ml)
      Storage Protect from moisture
      -20°C
      Hygroscopic
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Toxicity Harmful
      Merck USA index14, 3572
      ReferencesDalayeun, J.F., et al. 1993. Biomed. Pharmacother. 47, 311.
      Akil, H., et al. 1984. Annu. Rev. Neurosci. 7, 223.