05-23-2150 PACAP 38, Ovine - CAS 137061-48-4 - Calbiochem

View Pricing & Availability


Replacement Information

Key Spec Table

Empirical FormulaCAS #
C₂₀₃H₃₃₁N₆₃O₅₃S 137061-48-4

Pricing & Availability

Catalogue Number AvailabilityPackaging Qty/Pack Price Quantity
Retrieving availability...
Limited AvailabilityLimited Availability
In Stock 
Limited Quantities Available
Availability to be confirmed
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service
      Contact Customer Service

      Ampul plastik .1 mg
      Retrieving price...
      Price could not be retrieved
      Minimum Quantity needs to be mulitiple of
      Upon Order Completion More Information
      You Saved ()
      Request Pricing
      Retrieving availability...
      Limited AvailabilityLimited Availability
      In Stock 
      Limited Quantities Available
      Availability to be confirmed
        Remaining : Will advise
          Remaining : Will advise
          Will advise
          Contact Customer Service
          Contact Customer Service

          Ampul plastik 1 mg
          Retrieving price...
          Price could not be retrieved
          Minimum Quantity needs to be mulitiple of
          Upon Order Completion More Information
          You Saved ()
          Request Pricing
          OverviewMore active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50 = 7 nM).
          Catalogue Number05-23-2150
          Brand Family Calbiochem®
          SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
          ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
          Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
          Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
          Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.
          Product Information
          CAS number137061-48-4
          ATP CompetitiveN
          FormWhite to off-white solid
          Hill FormulaC₂₀₃H₃₃₁N₆₃O₅₃S
          Chemical formulaC₂₀₃H₃₃₁N₆₃O₅₃S
          Hygroscopic Hygroscopic
          Sold on the basis of peptide contentY
          Quality LevelMQ100
          Biological Information
          Primary TargetAdenylate cyclase
          Primary Target IC<sub>50</sub>EC50 = 7 nM against adenylate cyclase
          Purity≥96% by HPLC
          Physicochemical Information
          Cell permeableN
          Peptide ContentY
          Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂
          Materials Information
          Toxicological Information
          Safety Information according to GHS
          Safety Information
          Product Usage Statements
          Storage and Shipping Information
          Ship Code Ambient Temperature Only
          Toxicity Standard Handling
          Storage -20°C
          Hygroscopic Hygroscopic
          Do not freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
          Packaging Information
          Transport Information
          Supplemental Information


          PACAP 38, Ovine - CAS 137061-48-4 - Calbiochem MSDS


          Safety Data Sheet (SDS) 

          PACAP 38, Ovine - CAS 137061-48-4 - Calbiochem Certificates of Analysis

          TitleLot Number


          Reference overview
          Kobayashi, H., et al. 1994. Brain Res. 647, 145.
          Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
          Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
          Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.
          Data Sheet

          Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

          Revision12-May-2008 JSW
          SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
          DescriptionMore active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50 = 7 nM).
          FormWhite to off-white solid
          CAS number137061-48-4
          Chemical formulaC₂₀₃H₃₃₁N₆₃O₅₃S
          Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂
          Purity≥96% by HPLC
          Solubility5% Acetic Acid (1 mg/ml)
          Storage -20°C
          Do Not Freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
          Toxicity Standard Handling
          ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
          Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
          Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
          Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.