508514 Sigma-AldrichPsalmotoxin-1 - CAS 316808-68-1 - Calbiochem
A potent proton-gated sodium channel (ASIC1a) channel blocking neurotoxin (IC₅₀ = 0.9 nM) that can distinguish between the two ASIC1 splice variants, ASIC1a and ASIC1b.
More>> A potent proton-gated sodium channel (ASIC1a) channel blocking neurotoxin (IC₅₀ = 0.9 nM) that can distinguish between the two ASIC1 splice variants, ASIC1a and ASIC1b. Less<<Synonyms: ASIC1a Inhibitor, Psalmotoxin 1
Recommended Products
Overview
| Replacement Information |
|---|
Key Spec Table
| CAS # | Empirical Formula |
|---|---|
| 316808-68-1 | C₂₀₀H₃₁₂N₆₂O₅₇S₆ |
Pricing & Availability
| Catalogue Number | Availability | Packaging | Qty/Pack | Price | Quantity | |
|---|---|---|---|---|---|---|
| 5.08514.0001 |
|
Botol kaca | 20 μg |
|
— |
| References | |
|---|---|
| References | Qadri, Y. J. et al. 2009. J. Biol. Chem. 284, 17625. M. Mazzuca, et al. 2007. Nat Neurosci. 10, 943. Escoubas, P. et al. 2000. J. Biol. Chem. 275, 25116. |
| Product Information | |
|---|---|
| CAS number | 316808-68-1 |
| Form | Colorless semi-solid to viscous liquid |
| Hill Formula | C₂₀₀H₃₁₂N₆₂O₅₇S₆ |
| Chemical formula | C₂₀₀H₃₁₂N₆₂O₅₇S₆ |
| Hygroscopic | Hygroscopic |
| Quality Level | MQ100 |
| Applications |
|---|
| Biological Information | |
|---|---|
| Primary Target | ASIC1a |
| Primary Target IC<sub>50</sub> | 0.9 nM |
| Purity | ≥94% by HPLC |
| Physicochemical Information | |
|---|---|
| Peptide Sequence | EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT (disulfide bond 3-18, 10-23, 17-33) |
| Dimensions |
|---|
| Materials Information |
|---|
| Toxicological Information |
|---|
| Safety Information according to GHS |
|---|
| Safety Information |
|---|
| Product Usage Statements |
|---|
| Packaging Information |
|---|
| Transport Information |
|---|
| Supplemental Information |
|---|
| Specifications |
|---|
| Global Trade Item Number | |
|---|---|
| Catalogue Number | GTIN |
| 5.08514.0001 | 04055977262056 |
Documentation
Psalmotoxin-1 - CAS 316808-68-1 - Calbiochem MSDS
| Title |
|---|
References
| Reference overview |
|---|
| Qadri, Y. J. et al. 2009. J. Biol. Chem. 284, 17625. M. Mazzuca, et al. 2007. Nat Neurosci. 10, 943. Escoubas, P. et al. 2000. J. Biol. Chem. 275, 25116. |



