Millipore Sigma Vibrant Logo

208711 Ca2+/Calmodulin Kinase II Inhibitor 281-309 - Calbiochem

208711
가격 및 재고 조회

개요

Replacement Information

주요 사양표

Empirical Formula
C₁₄₆H₂₅₄N₄₆O₃₉S₃

가격 및 재고여부

카탈로그 번호 재고 정보패킹 포장 단위 가격(VAT 별도) 수량
208711-500UGCN
재고 정보 검색...
재고 없음재고 없음
예상 출고 가능일 
단종품
제한된 수량 가능
재고여부 확인
    Remaining: will advise
      Remaining: will advise
      추천사항
      고객 서비스로 문의
      Contact Customer Service

      Plastic ampoule 500 μg
      가격 검색...
      가격을 검색할 수 없습니다
      Minimum Quantity needs to be mulitiple of
      Maximum Quantity is
      가격 문의 추가 정보
      ()이 할인됨
       
      가격 문의
      Description
      OverviewA synthetic peptide that contains the CaM-binding, inhibitory, and autophosphorylation domains of CaM kinase II. Can be phosphorylated at Thr286 by PKC. Useful as a calmodulin binding peptide. Inhibits CaM kinase II (IC50 = 80 nM) by blocking Ca2+/calmodulin activation and enzyme active site (IC50 = 2 µM).
      Catalogue Number208711
      Brand Family Calbiochem®
      SynonymsCaM Kinase II Inhibitor 281-309, MHRQETVDCLKKFNARRKLKGAILTTMLA-OH
      References
      ReferencesWaxham, M.N., et al. 1993. Biochemistry 32, 2923.
      Waxham, M.N., et al. 1993. Brain Res. 609, 1.
      Fukunaga, K., et al. 1990. J. Neurochem. 54, 103.
      Colbran, R.J., et al. 1989. J. Biol. Chem. 264, 4800.
      Colbran, R.J., et al. 1988. J. Biol. Chem. 263, 18145.
      Product Information
      ATP CompetitiveN
      FormLyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      Hill FormulaC₁₄₆H₂₅₄N₄₆O₃₉S₃
      Chemical formulaC₁₄₆H₂₅₄N₄₆O₃₉S₃
      Hygroscopic Hygroscopic
      ReversibleN
      Sold on the basis of peptide contentY
      Quality LevelMQ100
      Applications
      Biological Information
      Primary TargetCaM Kinase II
      Primary Target IC<sub>50</sub>80nM
      Purity≥97% by HPLC
      Physicochemical Information
      Cell permeableN
      Peptide ContentY
      Peptide SequenceH-Met-His-Arg-Gln-Glu-Thr-Val-Asp-Cys-Leu-Lys-Lys-Phe-Asn-Ala-Arg-Arg-Lys-Leu-Lys-Gly-Ala-Ile-Leu-Thr-Thr-Met-Leu-Ala-OH
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Ambient Temperature Only
      Toxicity Standard Handling
      Storage -20°C
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Packaging Information
      Transport Information
      Supplemental Information
      Specifications

      Documentation

      Ca2+/Calmodulin Kinase II Inhibitor 281-309 - Calbiochem MSDS

      타이틀

      물질안전보건자료(MSDS) 

      Ca2+/Calmodulin Kinase II Inhibitor 281-309 - Calbiochem Certificates of Analysis

      TitleLot Number
      208711

      References

      참고문헌 보기
      Waxham, M.N., et al. 1993. Biochemistry 32, 2923.
      Waxham, M.N., et al. 1993. Brain Res. 609, 1.
      Fukunaga, K., et al. 1990. J. Neurochem. 54, 103.
      Colbran, R.J., et al. 1989. J. Biol. Chem. 264, 4800.
      Colbran, R.J., et al. 1988. J. Biol. Chem. 263, 18145.

      Citations

      타이틀
    • Liangwen Xiong, et al. (2005) A Ca2+ Binding Domain in RyR1 That Interacts with the Calmodulin Binding Site and Modulates Channel Activity. Biophysical Journal in press,.
    • Data Sheet

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision05-June-2008 RFH
      SynonymsCaM Kinase II Inhibitor 281-309, MHRQETVDCLKKFNARRKLKGAILTTMLA-OH
      DescriptionA synthetic peptide containing the calmodulin binding site (290-309) and the autophosphorylation site (Thr286) of CaM kinase II. Can be phosphorylated at Thr286 by PKC. Useful as a calmodulin binding peptide. Inhibits CaM kinase II by blocking Ca2+/calmodulin activation (IC50 = 80 nM) and enzyme-active site (IC50 = 2 µM).
      FormLyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      Chemical formulaC₁₄₆H₂₅₄N₄₆O₃₉S₃
      Peptide SequenceH-Met-His-Arg-Gln-Glu-Thr-Val-Asp-Cys-Leu-Lys-Lys-Phe-Asn-Ala-Arg-Arg-Lys-Leu-Lys-Gly-Ala-Ile-Leu-Thr-Thr-Met-Leu-Ala-OH
      Purity≥97% by HPLC
      SolubilityH₂O (5 mg/ml)
      Storage -20°C
      Hygroscopic
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Toxicity Standard Handling
      ReferencesWaxham, M.N., et al. 1993. Biochemistry 32, 2923.
      Waxham, M.N., et al. 1993. Brain Res. 609, 1.
      Fukunaga, K., et al. 1990. J. Neurochem. 54, 103.
      Colbran, R.J., et al. 1989. J. Biol. Chem. 264, 4800.
      Colbran, R.J., et al. 1988. J. Biol. Chem. 263, 18145.
      Citation
    • Liangwen Xiong, et al. (2005) A Ca2+ Binding Domain in RyR1 That Interacts with the Calmodulin Binding Site and Modulates Channel Activity. Biophysical Journal in press,.