Millipore Sigma Vibrant Logo

05-23-2150 PACAP 38, Ovine - CAS 137061-48-4 - Calbiochem

05-23-2150
가격 및 재고 조회

개요

Replacement Information

주요 사양표

CAS #Empirical Formula
137061-48-4C₂₀₃H₃₃₁N₆₃O₅₃S

가격 및 재고여부

카탈로그 번호 재고 정보패킹 포장 단위 가격(VAT 별도) 수량
05232150-0.1MGCN
재고 정보 검색...
재고 없음재고 없음
예상 출고 가능일 
단종품
제한된 수량 가능
재고여부 확인
    Remaining: will advise
      Remaining: will advise
      추천사항
      고객 서비스로 문의
      Contact Customer Service

      Plastic ampoule .1 mg
      가격 검색...
      가격을 검색할 수 없습니다
      Minimum Quantity needs to be mulitiple of
      Maximum Quantity is
      가격 문의 추가 정보
      ()이 할인됨
       
      가격 문의
      05232150-1MGCN
      재고 정보 검색...
      재고 없음재고 없음
      예상 출고 가능일 
      단종품
      제한된 수량 가능
      재고여부 확인
        Remaining: will advise
          Remaining: will advise
          추천사항
          고객 서비스로 문의
          Contact Customer Service

          Plastic ampoule 1 mg
          가격 검색...
          가격을 검색할 수 없습니다
          Minimum Quantity needs to be mulitiple of
          Maximum Quantity is
          가격 문의 추가 정보
          ()이 할인됨
           
          가격 문의
          Description
          OverviewMore active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50 = 7 nM).
          Catalogue Number05-23-2150
          Brand Family Calbiochem®
          SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
          References
          ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
          Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
          Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
          Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.
          Product Information
          CAS number137061-48-4
          ATP CompetitiveN
          FormWhite to off-white solid
          Hill FormulaC₂₀₃H₃₃₁N₆₃O₅₃S
          Chemical formulaC₂₀₃H₃₃₁N₆₃O₅₃S
          Hygroscopic Hygroscopic
          ReversibleN
          Sold on the basis of peptide contentY
          Quality LevelMQ100
          Applications
          Biological Information
          Primary TargetAdenylate cyclase
          Primary Target IC<sub>50</sub>EC50 = 7 nM against adenylate cyclase
          Purity≥96% by HPLC
          Physicochemical Information
          Cell permeableN
          Peptide ContentY
          Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂
          Dimensions
          Materials Information
          Toxicological Information
          Safety Information according to GHS
          Safety Information
          Product Usage Statements
          Storage and Shipping Information
          Ship Code Ambient Temperature Only
          Toxicity Standard Handling
          Storage -20°C
          Hygroscopic Hygroscopic
          Do not freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
          Packaging Information
          Transport Information
          Supplemental Information
          Specifications

          Documentation

          PACAP 38, Ovine - CAS 137061-48-4 - Calbiochem MSDS

          타이틀

          물질안전보건자료(MSDS) 

          PACAP 38, Ovine - CAS 137061-48-4 - Calbiochem Certificates of Analysis

          TitleLot Number
          05-23-2150

          References

          참고문헌 보기
          Kobayashi, H., et al. 1994. Brain Res. 647, 145.
          Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
          Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
          Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.
          Data Sheet

          Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

          Revision12-May-2008 JSW
          SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
          DescriptionMore active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50 = 7 nM).
          FormWhite to off-white solid
          CAS number137061-48-4
          Chemical formulaC₂₀₃H₃₃₁N₆₃O₅₃S
          Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂
          Purity≥96% by HPLC
          Solubility5% Acetic Acid (1 mg/ml)
          Storage -20°C
          Hygroscopic
          Do Not Freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
          Toxicity Standard Handling
          ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
          Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
          Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
          Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.