Millipore Sigma Vibrant Logo

05-23-2150 PACAP 38, Ovine - CAS 137061-48-4 - Calbiochem

05-23-2150
Voir les Prix & la Disponibilité

Aperçu

Replacement Information

Tableau de caractéristiques principal

CAS #Empirical Formula
137061-48-4C₂₀₃H₃₃₁N₆₃O₅₃S

Prix & Disponibilité

Référence DisponibilitéConditionnement Qté Prix Quantité
05-23-2150-0.1MG
Récupération des données relatives à la disponibilité...
Disponibilité limitéeDisponibilité limitée
En stock 
Interrompu(e)
Disponible en quantités limitées
Disponibilité à confirmer
    Pour le restant : Nous vous tiendrons informé
      Pour le restant : Nous vous tiendrons informé
      Nous vous tiendrons informé
      Contacter le Service Clients
      Contact Customer Service

      Ampoule plast. .1 mg
      Prix en cours de récupération
      Le prix n'a pas pu être récupéré
      La quantité minimale doit être un multiple de
      Maximum Quantity is
      À la validation de la commande Plus d'informations
      Vous avez sauvegardé ()
       
      Demander le prix
      05-23-2150-1MG
      Récupération des données relatives à la disponibilité...
      Disponibilité limitéeDisponibilité limitée
      En stock 
      Interrompu(e)
      Disponible en quantités limitées
      Disponibilité à confirmer
        Pour le restant : Nous vous tiendrons informé
          Pour le restant : Nous vous tiendrons informé
          Nous vous tiendrons informé
          Contacter le Service Clients
          Contact Customer Service

          Ampoule plast. 1 mg
          Prix en cours de récupération
          Le prix n'a pas pu être récupéré
          La quantité minimale doit être un multiple de
          Maximum Quantity is
          À la validation de la commande Plus d'informations
          Vous avez sauvegardé ()
           
          Demander le prix
          Description
          OverviewMore active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50 = 7 nM).
          Catalogue Number05-23-2150
          Brand Family Calbiochem®
          SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
          References
          ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
          Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
          Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
          Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.
          Product Information
          CAS number137061-48-4
          ATP CompetitiveN
          FormWhite to off-white solid
          Hill FormulaC₂₀₃H₃₃₁N₆₃O₅₃S
          Chemical formulaC₂₀₃H₃₃₁N₆₃O₅₃S
          Hygroscopic Hygroscopic
          ReversibleN
          Sold on the basis of peptide contentY
          Quality LevelMQ100
          Applications
          Biological Information
          Primary TargetAdenylate cyclase
          Primary Target IC<sub>50</sub>EC50 = 7 nM against adenylate cyclase
          Purity≥96% by HPLC
          Physicochemical Information
          Cell permeableN
          Peptide ContentY
          Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂
          Dimensions
          Materials Information
          Toxicological Information
          Safety Information according to GHS
          Safety Information
          Product Usage Statements
          Storage and Shipping Information
          Ship Code Ambient Temperature Only
          Toxicity Standard Handling
          Storage -20°C
          Hygroscopic Hygroscopic
          Do not freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
          Packaging Information
          Transport Information
          Supplemental Information
          Specifications

          Documentation

          PACAP 38, Ovine - CAS 137061-48-4 - Calbiochem FDS

          Titre

          Fiche de données de sécurité des matériaux (FDS) 

          PACAP 38, Ovine - CAS 137061-48-4 - Calbiochem Certificats d'analyse

          TitreNuméro de lot
          05-23-2150

          Références bibliographiques

          Aperçu de la référence bibliographique
          Kobayashi, H., et al. 1994. Brain Res. 647, 145.
          Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
          Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
          Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.
          Fiche technique

          Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

          Revision12-May-2008 JSW
          SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
          DescriptionMore active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50 = 7 nM).
          FormWhite to off-white solid
          CAS number137061-48-4
          Chemical formulaC₂₀₃H₃₃₁N₆₃O₅₃S
          Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂
          Purity≥96% by HPLC
          Solubility5% Acetic Acid (1 mg/ml)
          Storage -20°C
          Hygroscopic
          Do Not Freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
          Toxicity Standard Handling
          ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
          Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
          Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
          Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.