Skip to Content
Merck

HPA015284

Anti-HLTF antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-DNA-binding protein/plasminogen activator inhibitor 1 regulator, Anti-HIP, Anti-Helicase-like transcription factor, Anti-SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3, Anti-Sucrose nonfermenting protein 2-like 3

Sign In to View Organizational & Contract Pricing.

Select a Size

Change View

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IF, IHC
Citations:
5
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human, mouse, rat

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:50-1:200

immunogen sequence

LKKHGFKLGPAPKTLGFNLESGWGSGRAGPSYSMPVHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDLYYNTITNFSEKDRPENVHGGILADDMGLGK

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... HLTF(6596)

General description

HLTF (helicase-like transcription factor) is a seven DNA helicase domain containing member of the SWI/SNF (mating-type switching/sucrose non-fermenting) family. Studies in HeLa cells show six isoforms of this protein, with the full length protein having a molecular weight of 115kDa. The 95kDa form lacks the helicase domains, present at the C-terminal, which are involved in DNA repair. It is a human ortholog of yeast Rad5 protein. This protein contains a Rad5-like domain, and a SWI/SNF helicase domain. This domain contains a C2HC4 RING domain.

Immunogen

Helicase-like transcription factor recombinant protein epitope signature tag (PrEST)

Application

Anti-HLTF antibody is suitable for chromatin immunoprecipitation (ChIP). Anti-HLTF antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

HLTF (helicase-like transcription factor) interacts and binds with DNA to control transcription. It utilizes the energy of ATP hydrolysis for chromatin remodeling, which is basic to multiple cellular processes. It plays a role in post-replication DNA repair, where it functions as E3 ubiquitin ligase and uniquitinates proliferating cell nuclear antigen (PCNA). This protein, along with translesion synthesis polymerases, is recruited to chromatin by the tumor suppressor protein BRCA1 (breast cancer 1, early onset). In stalled damaged DNA replication, this protein repairs the gaps in the replication fork. HLTF is hypermethylated and inactivated in multiple cancers such as, esophageal, gastric, colorectal and uterine cancer. Its expression correlates with the progression of thyroid neoplasia. Thus, it has potential as a marker to differentiate benign from malignant thyroid tumors. In cervical cancer, it increases the DNA repair capacity, and thus, confers resistance to radiotherapy.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST73675

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Still not finding the right product?

or

Try our Product Selector Tool to narrow your options


Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)



Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library


Related Content

Prestige Antibodies Immunofluorescence Procedure


Peter Burkovics et al.
Nucleic acids research, 42(3), 1711-1720 (2013-11-08)
Stalling of replication forks at unrepaired DNA lesions can result in discontinuities opposite the damage in the newly synthesized DNA strand. Translesion synthesis or facilitating the copy from the newly synthesized strand of the sister duplex by template switching can
Vanessa Arcolia et al.
BMC cancer, 14, 492-492 (2014-07-10)
The preoperative characterization of thyroid nodules is a challenge for the clinicians. Fine-needle aspiration (FNA) is the commonly used pre-operative technique for diagnosis of malignant thyroid tumor. However, many benign lesions, with indeterminate diagnosis following FNA, are referred to surgery.
Rebecca A Helmer et al.
PloS one, 16(5), e0251132-e0251132 (2021-05-20)
Methylation of the HLTF gene in colorectal cancer (CRC) cells occurs more frequently in men than women. Progressive epigenetic silencing of HLTF in tumor cells is accompanied by negligible expression in the tumor microenvironment (TME). Cell line-derived xenografts (CDX) were