Attention: We have moved. Merck Millipore products are no longer available for purchase on MerckMillipore.com.Learn More

208711 Ca2+/Calmodulin Kinase II Inhibitor 281-309 - Calbiochem

208711
Purchase on Sigma-Aldrich

Overview

Replacement Information

Key Spec Table

Empirical Formula
C₁₄₆H₂₅₄N₄₆O₃₉S₃

Products

Catalogue NumberPackaging Qty/Pack
208711-500UG Plastic ampoule 500 μg
Description
OverviewA synthetic peptide that contains the CaM-binding, inhibitory, and autophosphorylation domains of CaM kinase II. Can be phosphorylated at Thr286 by PKC. Useful as a calmodulin binding peptide. Inhibits CaM kinase II (IC50 = 80 nM) by blocking Ca2+/calmodulin activation and enzyme active site (IC50 = 2 µM).
Catalogue Number208711
Brand Family Calbiochem®
SynonymsCaM Kinase II Inhibitor 281-309, MHRQETVDCLKKFNARRKLKGAILTTMLA-OH
References
ReferencesWaxham, M.N., et al. 1993. Biochemistry 32, 2923.
Waxham, M.N., et al. 1993. Brain Res. 609, 1.
Fukunaga, K., et al. 1990. J. Neurochem. 54, 103.
Colbran, R.J., et al. 1989. J. Biol. Chem. 264, 4800.
Colbran, R.J., et al. 1988. J. Biol. Chem. 263, 18145.
Product Information
ATP CompetitiveN
FormLyophilized solid
FormulationSupplied as a trifluoroacetate salt.
Hill FormulaC₁₄₆H₂₅₄N₄₆O₃₉S₃
Chemical formulaC₁₄₆H₂₅₄N₄₆O₃₉S₃
Hygroscopic Hygroscopic
ReversibleN
Sold on the basis of peptide contentY
Quality LevelMQ100
Applications
Biological Information
Primary TargetCaM Kinase II
Primary Target IC<sub>50</sub>80nM
Purity≥97% by HPLC
Physicochemical Information
Cell permeableN
Peptide ContentY
Peptide SequenceH-Met-His-Arg-Gln-Glu-Thr-Val-Asp-Cys-Leu-Lys-Lys-Phe-Asn-Ala-Arg-Arg-Lys-Leu-Lys-Gly-Ala-Ile-Leu-Thr-Thr-Met-Leu-Ala-OH
Dimensions
Materials Information
Toxicological Information
Safety Information according to GHS
Safety Information
Product Usage Statements
Storage and Shipping Information
Ship Code Ambient Temperature Only
Toxicity Standard Handling
Storage -20°C
Hygroscopic Hygroscopic
Do not freeze Ok to freeze
Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
Packaging Information
Transport Information
Supplemental Information
Specifications

Documentation

Ca2+/Calmodulin Kinase II Inhibitor 281-309 - Calbiochem SDS

Title

Safety Data Sheet (SDS) 

Ca2+/Calmodulin Kinase II Inhibitor 281-309 - Calbiochem Certificates of Analysis

TitleLot Number
208711

References

Reference overview
Waxham, M.N., et al. 1993. Biochemistry 32, 2923.
Waxham, M.N., et al. 1993. Brain Res. 609, 1.
Fukunaga, K., et al. 1990. J. Neurochem. 54, 103.
Colbran, R.J., et al. 1989. J. Biol. Chem. 264, 4800.
Colbran, R.J., et al. 1988. J. Biol. Chem. 263, 18145.

Citations

Title
  • Liangwen Xiong, et al. (2005) A Ca2+ Binding Domain in RyR1 That Interacts with the Calmodulin Binding Site and Modulates Channel Activity. Biophysical Journal in press,.
  • Data Sheet

    Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

    Revision05-June-2008 RFH
    SynonymsCaM Kinase II Inhibitor 281-309, MHRQETVDCLKKFNARRKLKGAILTTMLA-OH
    DescriptionA synthetic peptide containing the calmodulin binding site (290-309) and the autophosphorylation site (Thr286) of CaM kinase II. Can be phosphorylated at Thr286 by PKC. Useful as a calmodulin binding peptide. Inhibits CaM kinase II by blocking Ca2+/calmodulin activation (IC50 = 80 nM) and enzyme-active site (IC50 = 2 µM).
    FormLyophilized solid
    FormulationSupplied as a trifluoroacetate salt.
    Chemical formulaC₁₄₆H₂₅₄N₄₆O₃₉S₃
    Peptide SequenceH-Met-His-Arg-Gln-Glu-Thr-Val-Asp-Cys-Leu-Lys-Lys-Phe-Asn-Ala-Arg-Arg-Lys-Leu-Lys-Gly-Ala-Ile-Leu-Thr-Thr-Met-Leu-Ala-OH
    Purity≥97% by HPLC
    SolubilityH₂O (5 mg/ml)
    Storage -20°C
    Hygroscopic
    Do Not Freeze Ok to freeze
    Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
    Toxicity Standard Handling
    ReferencesWaxham, M.N., et al. 1993. Biochemistry 32, 2923.
    Waxham, M.N., et al. 1993. Brain Res. 609, 1.
    Fukunaga, K., et al. 1990. J. Neurochem. 54, 103.
    Colbran, R.J., et al. 1989. J. Biol. Chem. 264, 4800.
    Colbran, R.J., et al. 1988. J. Biol. Chem. 263, 18145.
    Citation
  • Liangwen Xiong, et al. (2005) A Ca2+ Binding Domain in RyR1 That Interacts with the Calmodulin Binding Site and Modulates Channel Activity. Biophysical Journal in press,.