208711 Ca2+/Calmodulin Kinase II Inhibitor 281-309 - Calbiochem

208711
View Pricing & Availability

Overview

Replacement Information

Key Spec Table

Empirical Formula
C₁₄₆H₂₅₄N₄₆O₃₉S₃

Pricing & Availability

Catalogue Number AvailabilityPackaging Qty/Pack Price Quantity
208711-500UG
Retrieving availability...
Limited AvailabilityLimited Availability
In Stock 
Discontinued
Limited Quantities Available
Availability to be confirmed
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service
      Contact Customer Service

      Plastic ampoule 500 μg
      Retrieving price...
      Price could not be retrieved
      Minimum Quantity needs to be mulitiple of
      Upon Order Completion More Information
      You Saved ()
       
      Request Pricing
      Description
      OverviewA synthetic peptide that contains the CaM-binding, inhibitory, and autophosphorylation domains of CaM kinase II. Can be phosphorylated at Thr286 by PKC. Useful as a calmodulin binding peptide. Inhibits CaM kinase II (IC50 = 80 nM) by blocking Ca2+/calmodulin activation and enzyme active site (IC50 = 2 µM).
      Catalogue Number208711
      Brand Family Calbiochem®
      SynonymsCaM Kinase II Inhibitor 281-309, MHRQETVDCLKKFNARRKLKGAILTTMLA-OH
      References
      ReferencesWaxham, M.N., et al. 1993. Biochemistry 32, 2923.
      Waxham, M.N., et al. 1993. Brain Res. 609, 1.
      Fukunaga, K., et al. 1990. J. Neurochem. 54, 103.
      Colbran, R.J., et al. 1989. J. Biol. Chem. 264, 4800.
      Colbran, R.J., et al. 1988. J. Biol. Chem. 263, 18145.
      Product Information
      ATP CompetitiveN
      FormLyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      Hill FormulaC₁₄₆H₂₅₄N₄₆O₃₉S₃
      Chemical formulaC₁₄₆H₂₅₄N₄₆O₃₉S₃
      Hygroscopic Hygroscopic
      ReversibleN
      Sold on the basis of peptide contentY
      Quality LevelMQ100
      Applications
      Biological Information
      Primary TargetCaM Kinase II
      Primary Target IC<sub>50</sub>80nM
      Purity≥97% by HPLC
      Physicochemical Information
      Cell permeableN
      Peptide ContentY
      Peptide SequenceH-Met-His-Arg-Gln-Glu-Thr-Val-Asp-Cys-Leu-Lys-Lys-Phe-Asn-Ala-Arg-Arg-Lys-Leu-Lys-Gly-Ala-Ile-Leu-Thr-Thr-Met-Leu-Ala-OH
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Ambient Temperature Only
      Toxicity Standard Handling
      Storage -20°C
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Packaging Information
      Transport Information
      Supplemental Information
      Specifications

      Documentation

      Ca2+/Calmodulin Kinase II Inhibitor 281-309 - Calbiochem SDS

      Title

      Safety Data Sheet (SDS) 

      Ca2+/Calmodulin Kinase II Inhibitor 281-309 - Calbiochem Certificates of Analysis

      TitleLot Number
      208711

      References

      Reference overview
      Waxham, M.N., et al. 1993. Biochemistry 32, 2923.
      Waxham, M.N., et al. 1993. Brain Res. 609, 1.
      Fukunaga, K., et al. 1990. J. Neurochem. 54, 103.
      Colbran, R.J., et al. 1989. J. Biol. Chem. 264, 4800.
      Colbran, R.J., et al. 1988. J. Biol. Chem. 263, 18145.

      Citations

      Title
    • Liangwen Xiong, et al. (2005) A Ca2+ Binding Domain in RyR1 That Interacts with the Calmodulin Binding Site and Modulates Channel Activity. Biophysical Journal in press,.
    • Data Sheet

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision05-June-2008 RFH
      SynonymsCaM Kinase II Inhibitor 281-309, MHRQETVDCLKKFNARRKLKGAILTTMLA-OH
      DescriptionA synthetic peptide containing the calmodulin binding site (290-309) and the autophosphorylation site (Thr286) of CaM kinase II. Can be phosphorylated at Thr286 by PKC. Useful as a calmodulin binding peptide. Inhibits CaM kinase II by blocking Ca2+/calmodulin activation (IC50 = 80 nM) and enzyme-active site (IC50 = 2 µM).
      FormLyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      Chemical formulaC₁₄₆H₂₅₄N₄₆O₃₉S₃
      Peptide SequenceH-Met-His-Arg-Gln-Glu-Thr-Val-Asp-Cys-Leu-Lys-Lys-Phe-Asn-Ala-Arg-Arg-Lys-Leu-Lys-Gly-Ala-Ile-Leu-Thr-Thr-Met-Leu-Ala-OH
      Purity≥97% by HPLC
      SolubilityH₂O (5 mg/ml)
      Storage -20°C
      Hygroscopic
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Toxicity Standard Handling
      ReferencesWaxham, M.N., et al. 1993. Biochemistry 32, 2923.
      Waxham, M.N., et al. 1993. Brain Res. 609, 1.
      Fukunaga, K., et al. 1990. J. Neurochem. 54, 103.
      Colbran, R.J., et al. 1989. J. Biol. Chem. 264, 4800.
      Colbran, R.J., et al. 1988. J. Biol. Chem. 263, 18145.
      Citation
    • Liangwen Xiong, et al. (2005) A Ca2+ Binding Domain in RyR1 That Interacts with the Calmodulin Binding Site and Modulates Channel Activity. Biophysical Journal in press,.