Attention: We have moved. Merck Millipore products are no longer available for purchase on MerckMillipore.com.Learn More

05-23-0930 β-Endorphin, Human

05-23-0930
  
Purchase on Sigma-Aldrich

Overview

Replacement Information

Key Spec Table

Empirical FormulaCAS #
C₁₅₈H₂₅₁N₃₉O₄₆S61214-51-5
Description
Overview

This product has been discontinued.

We apologize for the inconvenience, but we do not currently have an alternative product.





Neurohormone secreted by the pituitary gland. The most potent of the opioid peptides. More effective than morphine in tests of opioid receptor binding, analgesia, and catatonia. High doses cause rigidity and hypothermia in rats.
Catalogue Number05-23-0930
Brand Family Calbiochem®
Synonymsβ-Lipoprotein 61-91, Human, YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
References
ReferencesDalayeun, J.F., et al. 1993. Biomed. Pharmacother. 47, 311.
Akil, H., et al. 1984. Annu. Rev. Neurosci. 7, 223.
Product Information
CAS number61214-51-5
FormWhite to off-white lyophilized solid
FormulationSupplied as a trifluoroacetate salt.
Hill FormulaC₁₅₈H₂₅₁N₃₉O₄₆S
Chemical formulaC₁₅₈H₂₅₁N₃₉O₄₆S
Hygroscopic Hygroscopic
Sold on the basis of peptide contentY
Applications
Biological Information
Purity≥95% by HPLC
Physicochemical Information
Peptide ContentY
Peptide SequenceH-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu-OH
Dimensions
Materials Information
Toxicological Information
Safety Information according to GHS
RTECSJZ1650000
Safety Information
R PhraseR: 20/21/22

Harmful by inhalation, in contact with skin and if swallowed.
S PhraseS: 36

Wear suitable protective clothing.
Product Usage Statements
Storage and Shipping Information
Ship Code Ambient Temperature Only
Toxicity Harmful
Storage -20°C
Protect from Moisture Protect from moisture
Hygroscopic Hygroscopic
Do not freeze Ok to freeze
Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
Packaging Information
Transport Information
Supplemental Information
Specifications

Documentation

β-Endorphin, Human Certificates of Analysis

TitleLot Number
05-23-0930

References

Reference overview
Dalayeun, J.F., et al. 1993. Biomed. Pharmacother. 47, 311.
Akil, H., et al. 1984. Annu. Rev. Neurosci. 7, 223.
Data Sheet

Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

Revision18-September-2008 RFH
Synonymsβ-Lipoprotein 61-91, Human, YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
DescriptionNeurohormone secreted by the pituitary gland. The most potent of the opiate peptides. More effective than morphine in tests of opiate receptor binding, analgesia, and catatonia. High doses cause rigidity and hypothermia in rats.
FormWhite to off-white lyophilized solid
FormulationSupplied as a trifluoroacetate salt.
CAS number61214-51-5
RTECSJZ1650000
Chemical formulaC₁₅₈H₂₅₁N₃₉O₄₆S
Peptide SequenceH-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu-OH
Purity≥95% by HPLC
Solubility5% Acetic acid (1 mg/ml)
Storage -20°C
Hygroscopic
Protect from moisture
Do Not Freeze Ok to freeze
Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
Toxicity Harmful
Merck USA index14, 3572
ReferencesDalayeun, J.F., et al. 1993. Biomed. Pharmacother. 47, 311.
Akil, H., et al. 1984. Annu. Rev. Neurosci. 7, 223.