613571 Sigma-AldrichTIRAP Inhibitor Peptide, Control, Cell-Permeable - Calbiochem
The TIRAP Inhibitor Peptide, Control, Cell-Permeable serves as a control for TIRAP Inhibitor Peptide. This small molecule/inhibitor is primarily used for Inflammation/Immunology applications.
More>> The TIRAP Inhibitor Peptide, Control, Cell-Permeable serves as a control for TIRAP Inhibitor Peptide. This small molecule/inhibitor is primarily used for Inflammation/Immunology applications. Less<<Synonyms: Mal Peptide, MyD88-Adapter Like Peptide, Toll-interleukin 1 Receptor (TIR) domain-containing Adapter Protein Peptide, Ant-Tirap151-138, TIRAP Peptide, Control, (RQIKIWFQNRRMKWKKSVIAGGPAADRLQL)
Overview
| Replacement Information |
|---|
Key Spec Table
| Empirical Formula |
|---|
| C₁₆₃H₂₆₈N₅₂O₃₈S |
Pricing & Availability
| Catalogue Number | Availability | Packaging | Qty/Pack | Price | Quantity | |
|---|---|---|---|---|---|---|
| 613571-1MGCN |
|
Plastic ampoule | 1 mg |
|
— |
| Description | |
|---|---|
| Overview | A cell-permeable synthetic peptide containing mouse TIRAP151-138, reverse sequence, fused to the Drosophila Antennapedia sequence. Serves as a control for TIRAP Inhibitor Peptide (Cat. No. 613570). |
| Catalogue Number | 613571 |
| Brand Family | Calbiochem® |
| Synonyms | Mal Peptide, MyD88-Adapter Like Peptide, Toll-interleukin 1 Receptor (TIR) domain-containing Adapter Protein Peptide, Ant-Tirap151-138, TIRAP Peptide, Control, (RQIKIWFQNRRMKWKKSVIAGGPAADRLQL) |
| References | |
|---|---|
| References | Horng, T., et al. 2001. Nat. Immunol. 2, 835. |
| Product Information | |
|---|---|
| ATP Competitive | N |
| Form | White lyophilized solid |
| Formulation | Supplied as a trifluoroacetate salt. |
| Hill Formula | C₁₆₃H₂₆₈N₅₂O₃₈S |
| Chemical formula | C₁₆₃H₂₆₈N₅₂O₃₈S |
| Hygroscopic | Hygroscopic |
| Reversible | N |
| Quality Level | MQ100 |
| Applications |
|---|
| Biological Information | |
|---|---|
| Primary Target | Control for TIRAP inhibitor |
| Purity | ≥97% by HPLC |
| Physicochemical Information | |
|---|---|
| Cell permeable | Y |
| Peptide Sequence | H-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Ser-Val-Ile-Ala-Gly-Gly-Pro-Ala-Ala-Asp-Arg-Leu-Gln-Leu-OH |
| Dimensions |
|---|
| Materials Information |
|---|
| Toxicological Information |
|---|
| Safety Information according to GHS |
|---|
| Safety Information |
|---|
| Product Usage Statements |
|---|
| Packaging Information | |
|---|---|
| Packaged under inert gas | Packaged under inert gas |
| Transport Information |
|---|
| Supplemental Information |
|---|
| Specifications |
|---|
| Global Trade Item Number | |
|---|---|
| Catalogue Number | GTIN |
| 613571-1MGCN | 04055977263565 |
Documentation
TIRAP Inhibitor Peptide, Control, Cell-Permeable - Calbiochem SDS
| Title |
|---|
TIRAP Inhibitor Peptide, Control, Cell-Permeable - Calbiochem Certificates of Analysis
| Title | Lot Number |
|---|---|
| 613571 |
References
| Reference overview |
|---|
| Horng, T., et al. 2001. Nat. Immunol. 2, 835. |



