Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IF, IHC
Citations:
32
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
mouse, human
technique(s)
immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:500-1:1000
immunogen sequence
QRMKEQQELSLTEASLQKLQERRDQELRRLEEEACRAAQEFLESLNFDEIDECVRNIERSLSVGSEFSSELAESACEEKPNFNFSQPYPEEEVDEGFEADDDAFKDSPNPSEHGHSDQRTSGIRTSDDSSEEDPYMNDTVVPTSPSA
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... MYO10(4651)
General description
The gene MYO10 (unconventional myosin-10) is mapped to human chromosome 5p15.1. It belongs to the MyTH4-FERM (myosin tail homology 4-band 4.1, ezrin, radixin, moesin, or MF) family of myosins. The protein has a myosin motor domain, a neck consisting of three IQ motifs and a tail region with three pleckstrin homology domains.
Immunogen
Myosin-X recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-MYO10 antibody produced in rabbit has ben used in western blotting and immunofluorescence.
Anti-MYO10 antibody produced in rabbit has ben used in western blotting and immunofluorescence.
Biochem/physiol Actions
MYO10 (unconventional myosin-10) is a microtubule-binding myosin. It is essential for centrosome positioning. It is a target gene for microRNA miR-340. In breast cancer, miR-340 inhibits invasion by silencing MYO10, which is responsible for aggressiveness and metastasis in breast cancer. The MYO10 gene is also a direct target of miR-124. Silencing of this gene suppresses cell invasion and metastasis in node-positive non-small cell lung cancer. MYO10 also plays a significant role in wound healing, invadopodia formation and angiogenesis.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST85234
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
Try our Product Selector Tool to narrow your options
Storage Class
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
John Caltagarone et al.
Molecular and cellular neurosciences, 68, 120-130 (2015-05-06)
Dopamine transporter (DAT, SLC6A3) controls dopamine (DA) neurotransmission by mediating re-uptake of extracellular DA into DA neurons. DA uptake depends on the amount of DAT at the cell surface, and is therefore regulated by DAT subcellular distribution. Hence we used
NF-?B-mediated miR-124 suppresses metastasis of non-small-cell lung cancer by targeting MYO10.
Sun Y, et al.
Oncotarget, 6, 8244-8254 (2015)
Jeffrey Kroon et al.
Journal of immunology (Baltimore, Md. : 1950), 200(5), 1790-1801 (2018-02-02)
Leukocyte transendothelial migration is key to inflammation. Leukocytes first start rolling over the inflamed endothelium, followed by firmly adhering to it. Under inflammatory conditions, endothelial cells express small finger-like protrusions that stick out into the lumen. The function and regulation