Skip to Content
Merck

S9697

Superoxide Dismutase bovine

recombinant, expressed in E. coli, lyophilized powder, ≥2500 units/mg protein, ≥90% (SDS-PAGE)

Synonym(s):

Superoxide Dismutase 1 bovine, cytocuprein, erythrocuprein, hemocuprein, CU/ZN-SOD, SOD, SOD1, Superoxide: superoxide oxidoreductase

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

CAS Number:
UNSPSC Code:
12352204
NACRES:
NA.54
EC Number:
232-943-0
MDL number:
EC Number:
Specific activity:
≥2500 units/mg protein
Assay:
≥90% (SDS-PAGE)
Biological source:
bovine
Recombinant:
expressed in E. coli
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

bovine

recombinant

expressed in E. coli

assay

≥90% (SDS-PAGE)

form

lyophilized powder

specific activity

≥2500 units/mg protein

storage condition

(Tightly closed)

technique(s)

inhibition assay: suitable

color

white

optimum pH

7.8 (25 °C)

pH range

7.6-10.5

pI 

4.95

sequence note

MATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK

NCBI accession no.

storage temp.

−20°C

Quality Level

UniProt accession no.

General description

Research area: Cell Signaling

SOD from bovine erythrocytes was the first SOD to be found in mammalian tissues. There are three forms of SOD differentiated by the metal ions in the active site. These are Cu+2/Zn+2, Mn+2, and Fe+2 SOD. In vertebrates, Cu/Zn-SOD is found in the cytoplasm, chloroplast, and may be in extracellular space, while Mn-SOD is found in the mitochondrial matrix space and peroxisome. Fe-SOD is found in the chloroplast of prokaryotes and some higher plants.

Application

Superoxide Dismutase bovine has been used:

  • to construct a calibration curve for the evaluation of superoxide dismutase (SOD) enzyme activities
  • in a study to investigate where lipoproteins may affect the L-arginine-nitric oxide pathway
  • in a study to investigate the mass spectral evidence for carbonate-anion-radical-induced posttranslational modification of tryptophan to kynurenine in human Cu, Zn superoxide dismutase

Biochem/physiol Actions

Superoxide dismutase (SOD) catalyzes the dismutation of superoxide radicals to hydrogen peroxide and molecular oxygen. This reaction in turn activates redox-sensitive kinases and inactivates specific phosphatases to regulate redox-sensitive signaling pathway, including hypertrophy, proliferation, and migration. SOD serves as a potent antioxidant and protects the cells against the toxic effects of oxygen radicals. SOD may also suppress apoptosis by competing with nitric oxide (NO) for superoxide anion, which reacts with NO to form peroxynitrite, an inducer of apoptosis.

Preparation Note

Produced using animal component-free materials.
Reconstitute in 10 mM potassium phosphate, pH 7.4.

Analysis Note

Extinction coefficient: EmM= 10.3 (258 nM)
SOD has no significant absorbance peak at 280 nM because of the absence of tryptophan.

Other Notes

Inhibitors: cyanide, OH- (competitive), hydrogen peroxide
One unit will inhibit reduction of cytochrome c by 50% in a coupled system with xanthine oxidase at pH 7.8 at 25°C in a 3.0 ml reaction volume. Xanthine oxidase concentration should produce an initial ΔA550 of 0.025 ± 0.005 per min.

pictograms

Health hazard

signalword

Danger

hcodes

Hazard Classifications

Resp. Sens. 1

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

L Vergnani et al.
Circulation, 101(11), 1261-1266 (2000-03-22)
Native and oxidized LDLs (n-LDL and ox-LDL) are involved in the atherogenic process and affect endothelium-dependent vascular tone through their interaction with nitric oxide (NO). In this study we evaluated directly, by using a porphyrinic microsensor, the effect of increasing
Tohru Fukai et al.
Cardiovascular research, 55(2), 239-249 (2002-07-19)
Excessive production and/or inadequate removal of reactive oxygen species, especially superoxide anion (O(2)(*-)), have been implicated in the pathogenesis of many cardiovascular diseases, including atherosclerosis, hypertension, diabetes, and in endothelial dysfunction by decreasing nitric oxide (NO) bioactivity. Since the vascular
Lingyan Wang et al.
Oxidative medicine and cellular longevity, 2015, 217670-217670 (2015-08-22)
A major source of reactive oxygen species (ROS) generation is the mitochondria. By using flow cytometry of the mitochondrial fluorescent probe, MitoSOX Red, western blot of mitochondrial ROS scavenger Peroxiredoxin (Prx) 3 and fluorescence immunostaining, ELISA of cleaved caspases 3
Tohru Fukai et al.
Antioxidants & redox signaling, 15(6), 1583-1606 (2011-04-09)
Excessive reactive oxygen species Revised abstract, especially superoxide anion (O₂•-), play important roles in the pathogenesis of many cardiovascular diseases, including hypertension and atherosclerosis. Superoxide dismutases (SODs) are the major antioxidant defense systems against (O₂•-), which consist of three isoforms
Olga Manzhulo et al.
Acta histochemica, 120(8), 741-747 (2018-09-02)
Docosahexaenoic acid (DHA, 22:6 (n-3)) leads to recovery of locomotor functions observed of spinal cord injury (SCI) in rats. In present study, we characterized the expression of iba-1, CD86, CD163 in microglia/macrophages, to assess activation state and M1 (pro-inflammatory)/M2 (anti-inflammatory)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service