Skip to Content
Merck

HPA014600

Anti-MARCH1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-E3 ubiquitin-protein ligase MARCH1, Anti-MARCH- I, Anti-Membrane-associated RING finger protein 1, Anti-Membrane-associated RING-CH protein I, Anti-RING finger protein 171

Sign In to View Organizational & Contract Pricing.

Select a Size

Change View

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
4
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

KVYVQLWRRLKAYNRVIFVQNCPDTAKKLEKNFSCNVNTDIKDAVVVPVPQTGANSLPSAEGG

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MARCH1(55016)

General description

MARCH1 (membrane-associated ring finger (C3HC4) 1, E3 ubiquitin protein ligase) is a member of MARCH family of E3 ubiquitin ligases. This family is RING-v type ligases and has 11 members. Most proteins of this family have RING domain in their cytosolic N-terminal, and two transmembrane regions. MARCH1 is generally expressed on secondary lymphoid tissues, such as B-cells and dendritic cells. It is localized to plasma membrane and endosomes.

Immunogen

E3 ubiquitin-protein ligase MARCH1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

MARCH1 (membrane-associated ring finger (C3HC4) 1, E3 ubiquitin protein ligase) is involved in the maturation of dendritic cells. Its under-expression leads to stable surface expression of major histocompatibility (MHC) II, on dendritic cells. Its expression also determines the fate of CD98, post its endocytosis; whether CD98 is degraded or recycled. It is also capable of dimerization and auto-ubiquitination, thus, controlling its own expression. In antigen presenting cells (APCs), its expression is induced by interleukin (IL)-10, which leads to the suppression of MHCII expression. IL-10 is a strong anti-inflammatory cytokine and thus, MARCH1 plays a role in the suppression of immune response. It regulates the cell surface expression of its substrates such as, tumor necrosis factor-related apoptosis inducing ligand (TRAIL) receptor 1. It ubiquitinates and degrades TRAIL-R1, and maintains its steady state expression.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST72906

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany


Still not finding the right product?

or

Try our Product Selector Tool to narrow your options


Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)



Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library



Jacques Thibodeau et al.
European journal of immunology, 38(5), 1225-1230 (2008-04-05)
IL-10 is a potent anti-inflammatory cytokine interfering with antigen presentation by inducing the intracellular sequestration of MHC class II (MHC-II) molecules. Here we studied the contribution of membrane-associated RING-CH (MARCH) ubiquitin ligase family members to the IL-10-induced down-regulation of MHC-II
Marie-Claude Bourgeois-Daigneault et al.
Journal of immunology (Baltimore, Md. : 1950), 188(10), 4959-4970 (2012-04-18)
Some members of the membrane-associated RING-CH family of E3 ubiquitin ligases (MARCHs) are membrane-bound and target major players of the immune response. MARCH1 ubiquitinates and downregulates MHC class II expression in APCs. It is induced by IL-10 and despite a
Craig A Eyster et al.
Molecular biology of the cell, 22(17), 3218-3230 (2011-07-16)
Following endocytosis, internalized plasma membrane proteins can be recycled back to the cell surface or trafficked to late endosomes/lysosomes for degradation. Here we report on the trafficking of multiple proteins that enter cells by clathrin-independent endocytosis (CIE) and determine that