Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
Conjugate:
unconjugated
Clone:
6G4, monoclonal
Application:
ELISA (i), WB
Citations:
8
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
6G4, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
indirect ELISA: suitable, western blot: 1-5 μg/mL
isotype
IgG2aκ
GenBank accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... IL8(3576)
General description
Interleukin-8 (IL-8)/CXCL8 is an important chemoattractant cytokine and activator of neutrophils. It is liberated from endothelial cells, gingival fibroblasts, neutrophils, monocytes and phagocytes in the gingival crevice. IL-8 belongs to the CXC subfamily. This gene is located on human chromosome 4q13.3.
The protein encoded by this gene is a member of the CXC chemokine family. This chemokine is one of the major mediators of the inflammatory response. This chemokine is secreted by several cell types. It functions as a chemoattractant, and is also a potent angiogenic factor. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. This gene and other ten members of the CXC chemokine gene family form a chemokine gene cluster in a region mapped to chromosome 4q. (provided by RefSeq)
Immunogen
IL8 (AAH13615.1, 21 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Sequence
EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Biochem/physiol Actions
Interleukin-8 (IL-8) chemoattracts and activates neutrophils. It is involved in guiding neutrophils and oligodendrocytes to sites of infection. The protein also stimulates angiogenesis and tumor growth. It is also associated with inflammatory diseases.
Interleukin-8 (IL-8)/CXCL8 participates in the progression of peripheral muscle weakness in individuals with COPD (chronic obstructive pulmonary disease). It helps in the transport of neutrophils across endothelium, pulmonary epithelium and fibroblasts. CXCL8 induces adhesion of neutrophils to extracellular matrix proteins and cytokine-stimulated endothelial monolayers via interaction with CD11b/CD18 (β2-integrins).
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
Explore all of our products under Monoclonal Anti-IL8 antibody produced in mouse
— or —
Try our Product Selector Tool to narrow your options
Storage Class
10 - Combustible liquids
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Association between interleukin-8 levels and chronic periodontal disease: A PRISMA-compliant systematic review and meta-analysis
Finoti LS, et al.
Medicine, 96(22) (2017)
Pathophysiological roles of interleukin-8/CXCL8 in pulmonary diseases
Mukaida N.
American Journal of Physiology. Lung Cellular and Molecular Physiology, 284(4), L566-L577 (2003)
Satsuki Shimizu et al.
Scientific reports, 13(1), 5041-5041 (2023-03-29)
Infantile skin problems not only cause temporary pain and discomfort, but also have a long-term impact on health. Hence, the purpose of this cross-sectional study was to clarify the relationship between inflammatory cytokines and Malassezia fungal facial skin problems in