Saltar al contenido
Merck

HPA014245

Anti-MYOF antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-FER1L3, Anti-Fer-1-like protein 3, Anti-Myoferlin

Iniciar sesión para ver los precios por organización y contrato.

Seleccione un Tamaño

Cambiar Vistas

Acerca de este artículo

UNSPSC Code:
12352203
NACRES:
NA.41
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IF, IHC
Citations:
19
Servicio técnico
¿Necesita ayuda? Nuestro equipo de científicos experimentados está aquí para ayudarle.
Permítanos ayudarle


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

mouse, human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:200-1:500

immunogen sequence

TIDLVIGYDPPSAPHPNDLSGPSVPGMGGDGEEDEGDEDRLDNAVRGPGPKGPVGTVSEAQLARRLTKVKNSRRMLSNKPQDFQIRVRVIEGRQLSGNNIRPVV

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MYOF(26509)

General description

The gene MYOF (myoferlin) encodes a type II membrane protein that shares homology with dysferlin. It is predominantly expressed in developing muscle and extensively in cardiac muscle. It is a member of the ferlin family of proteins. These proteins contain C2 domains that are important in calcium-mediated membrane fusion events. Myoferlin is found to be associated with both plasma membrane and nuclear membrane.

Immunogen

Myoferlin recombinant protein epitope signature tag (PrEST)

Application

Anti-MYOF antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

Myoferlin is involved in the fusion of endomembrane with the plasma membrane in muscle cells and endothelial cells. It forms a complex with dynamin-2 (Dyn-2) and promotes the surface expression of vascular endothelial growth factor receptor 2. The protein complex of myoferlin-Dyn-2-Cav-1 (caveolin-1) participates in the processes of membrane fusion and fission. Myoferlin is also implicated in receptor-dependent endocytosis. It is crucial for muscle development and regeneration, and its expression is found to increase in skeletal muscle on injury. It participates in vesicle recycling and its deficiency can lead to accumulation of transferrin in the perinuclear endocytic recycling compartment in the myoblasts. It regulates postnatal muscle growth mediated by IGF1 (insulin-like growth factor 1).

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST71990

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Still not finding the right product?

Pruebe nuestra Herramienta de selección de productos para limitar sus opciones


Clase de almacenamiento

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)



Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos


Contenido relacionado

Prestige Antibodies Immunofluorescence Procedure


Leonithas I Volakis et al.
PloS one, 9(2), e86110-e86110 (2014-03-04)
Cell migration plays a central role in the invasion and metastasis of tumors. As cells leave the primary tumor, they undergo an epithelial to mesenchymal transition (EMT) and migrate as single cells. Epithelial tumor cells may also migrate in a
Hailong Shi et al.
Frontiers in oncology, 12, 905230-905230 (2022-09-24)
In contrast to normal cells, in which reactive oxygen species (ROS) are maintained in redox equilibrium, cancer cells are characterized by ectopic ROS accumulation. Myoferlin, a newly identified oncogene, has been associated with tumor metastasis, intracellular ROS production, and energy
Hyun Min Koh et al.
In vivo (Athens, Greece), 33(4), 1103-1108 (2019-07-08)
Multiple primary malignant tumors are common in patients with renal cell carcinoma. However, reports on the factors that can identify patients with a risk for subsequent primary malignancies have been lacking. This study aimed to investigate whether myoferlin expression can