Iniciar sesión para ver los precios por organización y contrato.
Seleccione un Tamaño
Cambiar Vistas
Acerca de este artículo
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
6
Servicio técnico
¿Necesita ayuda? Nuestro equipo de científicos experimentados está aquí para ayudarle.
Permítanos ayudarlebiological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunohistochemistry: 1:500- 1:1000
immunogen sequence
GVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLE
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CX3CL1(6376)
General description
C-X3-C motif chemokine ligand 1(CX3CL1), also known as fractalkine (FKN), is encoded by the gene mapped to human chromosome 16q21. The encoded protein acts as a chemotactic cytokine in a soluble form, or acts as a binding molecule in a membrane-attached form. CX3CL1 is characterized by a mucin-like stalk containing chemokine domain and single transmembrane domain with a short intracellular C-terminal. CX3CL1 belongs to the CX3C chemokine subfamily.
Immunogen
chemokine (C-X3-C motif) ligand 1 recombinant protein epitope signature tag (PrEST)
Application
Anti-CX3CL1 antibody produced in rabbit has been used in tissue microarray (TMA) immunostaining.
Biochem/physiol Actions
CX3CL1 interacts with its cognate receptor CX3CR1 and stimulates chemotaxis of macrophages to apoptotic lymphocytes. The protein also facilitates inflammatory processes in the central nervous system (CNS). CX3CL1 has been implicated in the molecular mechanism that controls cell adhesion, migration and survival of human prostate cancer cells. Hence, the protein has potential therapeutic approach to treatment of prostate cancer. Elevated expression of serum CX3CL1 has been observed in postmenopausal osteoporotic patients. Thus, it acts as a potential diagnostic marker and therapeutic target for anti-resorptive treatment in osteoporosis patients.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Other Notes
Corresponding Antigen APREST81765
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
Clase de almacenamiento
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Elija entre una de las versiones más recientes:
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Yi-Ding Chen et al.
British journal of biomedical science, 73(3), 121-128 (2016-08-02)
The chemokine (C-X3-C motif) ligand 1 (CX3CL1), also called fractalkine (FKN), has recently been reported to be involved in osteoclastogenic process and pathological bone destruction. This study aimed to investigate the link between serum CX3CL1/FKN levels with disease progression of
WangMi Liu et al.
Archivum immunologiae et therapiae experimentalis, 64(5), 371-383 (2016-04-22)
Chemokines are a family of small 8-10 kDa inducible cytokines. Initially characterized as chemotactic factors, they are now considered to affect not just cellular recruitment. CX3CL1 is a unique chemokine that can exist in a soluble form, as a chemotactic cytokine
Lucy A Truman et al.
Blood, 112(13), 5026-5036 (2008-09-19)
Cells undergoing apoptosis are efficiently located and engulfed by phagocytes. The mechanisms by which macrophages, the professional scavenging phagocytes of apoptotic cells, are attracted to sites of apoptosis are poorly defined. Here we show that CX3CL1/fractalkine, a chemokine and intercellular