Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
NACRES:
NA.41
UNSPSC Code:
12352203
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC, WB
Citations:
2
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
95 kDa
species reactivity
horse, rat, dog, rabbit, guinea pig, human, bovine, mouse
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable, western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... NFATC4(4776)
General description
NFATC4 forms a part of a DNA-binding transcription complex that consists of inducible cytosolic and nuclear components. NFATC4 is involved in modulating neurotrophin-mediated synaptic plasticity and can also induce interleukins 2 and 4. p38 Mitogen-activated protein (MAP) kinases can regulate NFATC4 phosphorylation.
Rabbit Anti-NFATC4 antibody recognizes canine, bovine, human, mouse, and rat NFATC4.
Rabbit Anti-NFATC4 antibody recognizes canine, bovine, human, mouse, and rat NFATC4.
Immunogen
Synthetic peptide directed towards the middle region of human NFATC4
Application
Rabbit Anti-NFATC4 antibody can be used for western blot (1.25μg/ml) and IHC (4-8μg/ml) applications.
Biochem/physiol Actions
NFATC4 is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family of nuclear factors of activated T cells also participate in the formation of this complex. NFATC4 plays a role in the inducible expression of cytokine genes in T cells, especially in the induction of the IL-2 and IL-4.The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family of nuclear factors of activated T cells also participate in the formation of this complex. The product of this gene plays a role in the inducible expression of cytokine genes in T cells, especially in the induction of the IL-2 and IL-4.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTV
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
Explore all of our products under Anti-NFATC4 antibody produced in rabbit
— or —
Try our Product Selector Tool to narrow your options
Storage Class
10 - Combustible liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Rachel D Groth et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 23(22), 8125-8134 (2003-09-05)
A member of the neurotrophin family, brain-derived neurotrophic factor (BDNF) regulates neuronal survival and differentiation during development. Within the adult brain, BDNF is also important in neuronal adaptive processes, such as the activity-dependent plasticity that underlies learning and memory. These
Teddy T C Yang et al.
Molecular and cellular biology, 22(11), 3892-3904 (2002-05-09)
Nuclear factor of activated T cells (NFAT) is implicated in multiple biological processes, including cytokine gene expression, cardiac hypertrophy, and adipocyte differentiation. A conserved NFAT homology domain is identified in all NFAT members. Dephosphorylation of the NFAT homology region is