Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IF, IHC
Citations:
21
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:200-1:500
immunogen sequence
DASQELEISEHMKEPQLSDSIASDPKSFHGLDFGFRSRISEHLLDVDVLSPVLGGACRQAQQPLGIEDKDDSQSSQDELQSKQSKGLEERLSPPLPHE
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CEP164(22897)
General description
Centrosomal protein 164 (CEP164) is a centriole appendage protein encoded by the gene mapped to human chromosome 11q23.3. CEP164 is apparently a 164kDa protein composed of 1,460 amino acids and is specifically localized on mature centrioles. The encoded protein mainly contains a putative N-terminal WW domain and three coiled-coil domains.
Immunogen
centrosomal protein 164kDa recombinant protein epitope signature tag (PrEST)
Biochem/physiol Actions
Centrosomal protein 164 (CEP164) plays an essential role in primary cilium formation. In addition, it also acts as a potential marker for distal appendages on mature centrioles or basal bodies. Mutation in the gene is associated with early defects in ciliogenesis. CEP164 directs tau tubulin kinase 2 (TTBK2) to the mother centriole and thus stimulates ciliogenesis.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Other Notes
Corresponding Antigen APREST80528
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
Explore all of our products under Anti-CEP164 antibody produced in rabbit
— or —
Try our Product Selector Tool to narrow your options
Storage Class
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
CEP164-null cells generated by genome editing show a ciliation defect with intact DNA repair capacity.
Journal of Cell Science, 129, 1769-1774 (2016)
MLL partner genes in secondary acute lymphoblastic leukemia: report of a new partner PRRC1 and review of the literature.
Douet-Guilbert N
Leukemia Research, 38, 1316-1319 (2014)
Ebtissal M Khouj et al.
Journal of cell science, 132(19) (2019-09-08)
Centrin 2 is a small conserved calcium-binding protein that localizes to the centriolar distal lumen in human cells. It is required for efficient primary ciliogenesis and nucleotide excision repair (NER). Centrin 2 forms part of the xeroderma pigmentosum group C