Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
eCl@ss:
32160702
biological source
rabbit
Quality Segment
antibody form
affinity purified immunoglobulin
antibody product type
primary antibodies
clone
polyclonal
purified by
affinity chromatography
species reactivity
rat, human, mouse
manufacturer/tradename
Upstate®
technique(s)
immunocytochemistry: suitable, immunohistochemistry: suitable (paraffin), immunoprecipitation (IP): suitable, western blot: suitable
isotype
IgG
NCBI accession no.
UniProt accession no.
shipped in
wet ice
Gene Information
human ... GAB1(2549)
mouse ... Gab1(14388)
rat ... Gab1(361388)
General description
115 kDa
Gab1 is a 115 kDa multiple docking protein that plays an essential role in cellular growth, transformation and apoptosis. Gab1 can be phosphorylated by multiple receptor tyrosine kinase (RTKs), including: insulin receptor (IR), platelet derived growth factor receptor beta] (PDGFR-β]), hepatocyte growth factor/scatter factor receptor (HGFR/SFR or c Met), and epidermal growth factor receptor (EGF), as well as in response to cell cell adhesion. Gab1 is tyrosine phosphorylated on at least 16 sites, some of which serve as binding sites for phosphoatidylinositol 3 kinase (PI3K), Grb2, PLC gamma 1, Nck, and SHP2. Phosphorylation of Gab1 on tyrosines 627 and 659 is critical for its binding to SHP2, and for activation of the ERK/MAPK pathway in response to EGF.
Immunogen
31 residue peptide sequence corresponding to C-terminal residues 664-694 of Gab1 (CQKTLALKSTREAWTDGRQSTESETPAKSVK).
Epitope: C-terminus
Application
Anti-Gab1 Antibody, CT detects level of Gab1 & has been published & validated for use in IC, IH(P), IP & WB.
Immunoprecipitation:
4 μg of this lot immunoprecipitated Gab1 from 500 μg of a human A431 carcinoma cell RIPA lysate.
Immunocytochemistry:
10 μg/mL of a previous lot showed positive immunostaining for Gab1 in A431 cells fixed with 4% paraformaldehyde.
4 μg of this lot immunoprecipitated Gab1 from 500 μg of a human A431 carcinoma cell RIPA lysate.
Immunocytochemistry:
10 μg/mL of a previous lot showed positive immunostaining for Gab1 in A431 cells fixed with 4% paraformaldehyde.
Research Category
Signaling
Signaling
Research Sub Category
MAP Kinases
MAP Kinases
Biochem/physiol Actions
Reactivity with other species has not been confirmed.
Specific for Gab1. No other known protein shares more than 10 amino acids with the immunizing sequence.
Physical form
Affinity purified
Affinity purified IgG in buffer containing 0.1 M Tris-glycine, pH 7.4, 0.15 M NaCl, 0.05% sodium azide. Frozen solution.
Preparation Note
Stable for 1 year at -20ºC from date of receipt.
Handling Recommendations: Upon receipt, and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance. Note: Variability in freezer temperatures below -20°C may cause glycerol containing solutions to become frozen during storage.
Handling Recommendations: Upon receipt, and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance. Note: Variability in freezer temperatures below -20°C may cause glycerol containing solutions to become frozen during storage.
Analysis Note
Control
Non-stimulated A431 carcinoma cell lysate or NIH/3T3 cytoplasmic lysate.
Non-stimulated A431 carcinoma cell lysate or NIH/3T3 cytoplasmic lysate.
Routinely evaluated by Western Blot on RIPA lysates from human A431 carcinoma cells.
Western Blot Analysis:
0.5-2 μg/mL of this lot detected Gab1 in RIPA lysates from human A431 carcinoma cells.
Western Blot Analysis:
0.5-2 μg/mL of this lot detected Gab1 in RIPA lysates from human A431 carcinoma cells.
Other Notes
Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Legal Information
UPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
Try our Product Selector Tool to narrow your options
Storage Class
12 - Non Combustible Liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.