Skip to Content
Merck

06-579

Anti-Gab1 Antibody, CT

Upstate®, from rabbit

Synonym(s):

GRB2-associated binder, GRB2-associated binding protein, Growth factor receptor bound protein 2-associated protein

Sign In to View Organizational & Contract Pricing.

Select a Size

Change View

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
eCl@ss:
32160702
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist


biological source

rabbit

Quality Level

antibody form

affinity purified immunoglobulin

antibody product type

primary antibodies

clone

polyclonal

purified by

affinity chromatography

species reactivity

rat, human, mouse

manufacturer/tradename

Upstate®

technique(s)

immunocytochemistry: suitable, immunohistochemistry: suitable (paraffin), immunoprecipitation (IP): suitable, western blot: suitable

isotype

IgG

NCBI accession no.

UniProt accession no.

shipped in

wet ice

Gene Information

human ... GAB1(2549)
mouse ... Gab1(14388)
rat ... Gab1(361388)

General description

115 kDa
Gab1 is a 115 kDa multiple docking protein that plays an essential role in cellular growth, transformation and apoptosis. Gab1 can be phosphorylated by multiple receptor tyrosine kinase (RTKs), including: insulin receptor (IR), platelet derived growth factor receptor beta] (PDGFR-β]), hepatocyte growth factor/scatter factor receptor (HGFR/SFR or c Met), and epidermal growth factor receptor (EGF), as well as in response to cell cell adhesion. Gab1 is tyrosine phosphorylated on at least 16 sites, some of which serve as binding sites for phosphoatidylinositol 3 kinase (PI3K), Grb2, PLC gamma 1, Nck, and SHP2. Phosphorylation of Gab1 on tyrosines 627 and 659 is critical for its binding to SHP2, and for activation of the ERK/MAPK pathway in response to EGF.

Immunogen

31 residue peptide sequence corresponding to C-terminal residues 664-694 of Gab1 (CQKTLALKSTREAWTDGRQSTESETPAKSVK).
Epitope: C-terminus

Application

Anti-Gab1 Antibody, CT detects level of Gab1 & has been published & validated for use in IC, IH(P), IP & WB.
Immunoprecipitation:
4 μg of this lot immunoprecipitated Gab1 from 500 μg of a human A431 carcinoma cell RIPA lysate.

Immunocytochemistry:
10 μg/mL of a previous lot showed positive immunostaining for Gab1 in A431 cells fixed with 4% paraformaldehyde.
Research Category
Signaling
Research Sub Category
MAP Kinases

Biochem/physiol Actions

Reactivity with other species has not been confirmed.
Specific for Gab1. No other known protein shares more than 10 amino acids with the immunizing sequence.

Physical form

Affinity purified
Affinity purified IgG in buffer containing 0.1 M Tris-glycine, pH 7.4, 0.15 M NaCl, 0.05% sodium azide. Frozen solution.

Preparation Note

Stable for 1 year at -20ºC from date of receipt.
Handling Recommendations: Upon receipt, and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance. Note: Variability in freezer temperatures below -20°C may cause glycerol containing solutions to become frozen during storage.

Analysis Note

Control
Non-stimulated A431 carcinoma cell lysate or NIH/3T3 cytoplasmic lysate.
Routinely evaluated by Western Blot on RIPA lysates from human A431 carcinoma cells.

Western Blot Analysis:
0.5-2 μg/mL of this lot detected Gab1 in RIPA lysates from human A431 carcinoma cells.

Other Notes

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

Legal Information

UPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Still not finding the right product?

Try our Product Selector Tool to narrow your options


Storage Class

12 - Non Combustible Liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable



Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library



Alessandro Furlan et al.
PloS one, 7(10), e46738-e46738 (2012-10-17)
The development of targeted molecular therapies has provided remarkable advances into the treatment of human cancers. However, in most tumors the selective pressure triggered by anticancer agents encourages cancer cells to acquire resistance mechanisms. The generation of new rationally designed
Identification of epidermal growth factor receptor- Grb2-associated binder-1-SHP-2 complex formation and its functional loss during neoplastic cell progression.
H Kameda, J I Risinger, B B Han, S J Baek, J C Barrett, W C Glasgow, T E Eling
Cell Growth & Differentiation : the Molecular Biology Journal of the American Association For Cancer Research null
Expression of Gab1 lacking the pleckstrin homology domain is associated with neoplastic progression.
Kameda, H; Risinger, JI; Han, BB; Baek, SJ; Barrett, JC; Abe, T; Takeuchi, T; Glasgow, WC; Eling, TE
Molecular and cellular biology null