Skip to Content
Merck

HPA012063

Anti-PARP14 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-ARTD8, Anti-BAL2, Anti-B aggressive lymphoma protein 2, Anti-PARP-14, Anti-Poly [ADP-ribose] polymerase 14

Sign In to View Organizational & Contract Pricing.

Select a Size

Change View

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IF, IHC
Citations:
11
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:50-1:200

immunogen sequence

AKEQESRADCISEFIEWQYNDNNTSHCFNKMTNLKLEDARREKKKTVDVKINHRHYTVNLNTYTATDTKGHSLSVQRLTKSKVDIPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTCS

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PARP14(54625)

General description

Poly(ADP-ribose) polymerase family member 14 (PARP14) is a nuclear protein encoded by the gene mapped to human chromosome 3q21.1. It is a member of PARP superfamily of proteins with PARP catalytic domain.

Immunogen

Poly [ADP-ribose] polymerase 14 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Poly(ADP-ribose) polymerase family member 14 (PARP14) has been used in immunohistochemistry and western blotting.

Biochem/physiol Actions

PARP14 (Poly ADP-ribose polymerase family, member 14) is a unique protein with its PARP domain-mediated MARylation activity. It is a member of the 18 poly-ADP ribosyl polymerase (PARP) family consisting of three macrodomains responsible for the ADP-ribosyltransferase activity. It is involved in the DNA replication mechanisms of DNA lesions and common fragile sites. The cytokine-stimulated STAT6 DNA activates the functional attributes of PARP14. It mainly stabilizes the DNA structure during replication event by minimizing the replication stress and promoting homologous recombination (HR) DNA repair. It controls various signaling pathways such as NFκB activity, B cell transcriptional regulation. It also acts as a cofactor for signal transducer and activator of transcription STAT6 activity.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST71522

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Still not finding the right product?

or

Try our Product Selector Tool to narrow your options


Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)



Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library


Related Content

Prestige Antibodies Immunofluorescence Procedure


Silvia Yumnam et al.
Oncology reports, 40(6), 3249-3260 (2018-10-03)
Proteomic analysis serves as an important biological tool for identifying biological events. Novel biomarkers of a specific disease such as cancer may be identified using these promising techniques. The aim of the present study was to investigate the effect of
The PARP superfamily
Ame J, et al.
Bioessays, 26(8), 882-893 (2004)
Michael Mentz et al.
Leukemia, 36(9), 2281-2292 (2022-07-20)
The variable clinical course of follicular lymphoma (FL) is determined by the molecular heterogeneity of tumor cells and complex interactions within the tumor microenvironment (TME). IL-4 producing follicular helper T cells (TFH) are critical components of the FL TME. Binding